You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10126
Secondary Accession Numbers
  • 16082
Name Probable ubiquitin carboxyl-terminal hydrolase FAF-X
Synonyms
  1. Deubiquitinating enzyme FAF-X
  2. Fat facets in mammals
  3. Fat facets protein-related, X-linked
  4. Ubiquitin thiolesterase FAF-X
  5. Ubiquitin-specific protease 9, X chromosome
  6. Ubiquitin-specific-processing protease FAF-X
  7. hFAM
Gene Name USP9X
Protein Type Enzyme
Biological Properties
General Function Involved in binding
Specific Function Deubiquitinase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. May therefore play an important role regulatory role at the level of protein turnover by preventing degradation of proteins through the removal of conjugated ubiquitin. Essential component of TGF-beta/BMP signaling cascade. Regulates chromosome alignment and segregation in mitosis by regulating the localization of BIRC5/survivin to mitotic centromeres. Specifically hydrolyzes both 'Lys-29'- and 'Lys-33'-linked polyubiquitins chains. Specifically deubiquitinates monoubiquitinated SMAD4, opposing the activity of E3 ubiquitin-protein ligase TRIM33
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
ubiquitin thiolesterase activity
thiolester hydrolase activity
Process
metabolic process
catabolic process
macromolecule catabolic process
cellular macromolecule catabolic process
modification-dependent macromolecule catabolic process
modification-dependent protein catabolic process
ubiquitin-dependent protein catabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs USP9X
Gene Sequence
>7665 bp
ATGACAGCCACGACTCGTGGCTCTCCGGTCGGAGGGAATGACAACCAGGGCCAGGCTCCT
GATGGACAGTCTCAGCCCCCCCTCCAACAGAATCAGACTTCATCGCCTGATTCTTCCAAT
GAAAATTCCCCGGCAACTCCCCCAGATGAGCAAGGTCAAGGTGATGCCCCACCACAGCTT
GAAGATGAGGAACCTGCATTTCCACATACTGACTTGGCCAAGTTGGATGACATGATCAAC
AGGCCTCGATGGGTGGTTCCAGTTTTGCCGAAAGGGGAATTAGAAGTGCTTTTAGAAGCT
GCTATTGATCTTAGTAAAAAGGGCCTTGATGTTAAAAGTGAAGCATGTCAGCGATTTTTC
CGTGATGGGCTAACAATATCATTCACTAAAATTCTTACAGATGAAGCAGTGAGTGGCTGG
AAGTTTGAAATTCATAGGTGTATTATTAACAATACTCATCGTCTGGTGGAGCTATGTGTG
GCCAAGTTGTCCCAAGACTGGTTTCCACTTTTAGAACTTCTTGCCATGGCCTTAAATCCT
CATTGCAAATTCCATATCTACAATGGTACACGTCCATGTGAATCAGTTTCCTCAAGTGTT
CAGTTGCCTGAAGATGAACTCTTTGCTCGTTCTCCAGATCCTCGATCACCAAAGGGTTGG
CTAGTGGATCTTCTCAACAAATTTGGCACTTTAAATGGGTTCCAGATTTTGCATGATCGT
TTTATTAATGGATCAGCATTAAACGTTCAAATAATTGCAGCCCTTATTAAACCATTTGGG
CAATGCTATGAGTTTCTCACTCTTCATACAGTGAAAAAGTACTTTCTTCCAATAATAGAA
ATGGTTCCACAGTTTTTAGAAAACTTAACTGATGAAGAACTGAAAAAAGAAGCAAAGAAT
GAAGCCAAAAATGATGCTCTTTCAATGATTATTAAATCTTTGAAGAATTTAGCTTCAAGG
GTTCCAGGACAAGAAGAAACTGTTAAAAACTTAGAAATATTTAGGTTAAAAATGATACTT
AGATTATTGCAAATTTCTTCTTTCAATGGAAAGATGAATGCACTGAATGAAGTTAATAAG
GTGATATCTAGTGTATCATACTATACTCATCGACATGGTAATCCTGAGGAGGAAGAGTGG
CTCACAGCTGAACGAATGGCAGAATGGATACAGCAGAACAATATCTTATCCATAGTGTTG
CGAGATAGTCTTCATCAGCCACAGTATGTAGAAAAGTTAGAGAAGATTCTTCGTTTTGTC
ATCAAAGAAAAAGCTCTGACCTTACAGGATCTTGATAATATCTGGGCAGCACAGGCAGGG
AAACATGAAGCCATTGTGAAGAATGTACATGATCTCCTGGCAAAATTGGCATGGGATTTT
TCTCCTGAACAACTTGATCATCTTTTTGATTGTTTTAAGGCCAGTTGGACAAATGCGAGT
AAAAAGCAACGTGAAAAGCTACTTGAGCTGATACGTCGTCTTGCAGAAGATGATAAAGAT
GGTGTGATGGCACACAAAGTGTTGAACCTTCTGTGGAATCTGGCTCACAGTGATGATGTG
CCTGTAGATATCATGGACCTGGCTCTCAGTGCCCACATAAAAATACTAGATTACAGTTGC
TCCCAGGACCGTGATACACAAAAGATCCAATGGATAGATCGCTTTATAGAAGAACTTCGC
ACAAATGACAAATGGGTTATTCCCGCACTGAAACAAATTAGAGAAATTTGTAGTTTGTTT
GGTGAAGCGCCTCAAAATTTGAGTCAAACTCAGCGAAGTCCCCATGTGTTTTATCGCCAT
GACTTAATCAATCAACTTCAACACAATCATGCCCTAGTTACTTTGGTAGCAGAAAACCTT
GCAACTTACATGGAAAGCATGAGACTATATGCTAGAGACCATGAAGATTATGACCCACAA
ACTGTGAGGCTGGGAAGTAGATATAGTCATGTTCAAGAAGTTCAAGAACGGCTTAACTTC
CTTAGATTTTTATTGAAGGATGGTCAGCTGTGGCTATGTGCTCCTCAGGCAAAACAAATA
TGGAAATGCTTAGCTGAGAATGCAGTTTACCTTTGTGATCGTGAAGCCTGTTTTAAGTGG
TATTCCAAGTTGATGGGGGATGAACCAGACTTAGATCCTGATATTAATAAGGACTTCTTT
GAAAGTAATGTGCTTCAGCTTGATCCTTCTCTGTTAACTGAAAATGGAATGAAGTGTTTT
GAGCGATTCTTCAAAGCTGTGAATTGTCGAGAAGGAAAACTAGTAGCAAAAAGGAGAGCC
TATATGATGGATGACTTGGAGTTAATAGGATTAGATTACCTTTGGAGGGTCGTGATTCAG
AGTAATGATGATATTGCCAGCAGAGCTATAGATCTCCTCAAAGAGATATACACGAACCTT
GGTCCAAGACTACAAGTCAATCAGGTGGTGATCCATGAAGACTTCATTCAGTCTTGTTTT
GATCGTCTGAAGGCTTCCTATGACACATTGTGTGTTTTGGATGGTGACAAAGACAGTGTT
AATTGTGCAAGACAGGAAGCTGTTCGAATGGTTCGAGTATTAACTGTTTTAAGGGAATAT
ATAAATGAATGTGACAGTGATTATCATGAGGAAAGAACAATTCTCCCTATGTCGAGAGCA
TTCCGCGGTAAACACCTCTCTTTTGTAGTTCGATTTCCAAACCAGGGCAGACAGGTTGAT
GACTTGGAGGTATGGTCTCATACAAATGATACAATTGGTTCAGTACGACGATGTATTCTC
AATCGTATTAAAGCCAACGTAGCCCATACAAAAATTGAGCTCTTTGTGGGCGGTGAGCTG
ATAGATCCTGCAGATGATAGAAAGTTGATTGGACAATTAAACTTAAAAGATAAATCGCTT
ATTACAGCCAAACTTACACAGATAAGTTCCAATATGCCTTCAAGCCCTGATAGCTCTTCT
GATTCCTCCACTGGATCTCCTGGAAACCATGGTAATCATTACAGTGATGGTCCCAATCCA
GAAGTGGAAAGCTGTTTGCCTGGAGTGATAATGTCACTGCATCCCAGATACATCTCTTTT
CTTTGGCAAGTTGCAGACTTAGGTAGCAGCCTAAATATGCCACCCCTTAGAGATGGAGCA
AGAGTACTTATGAAACTTATGCCGCCAGATAGCACAACGATAGAAAAATTAAGAGCTATT
TGTTTAGACCATGCCAAACTTGGAGAAAGCAGCCTTAGTCCATCTCTTGACTCACTTTTC
TTTGGTCCTTCAGCCTCACAAGTGCTATATCTAACAGAGGTAGTCTATGCCTTGTTAATG
CCTGCTGGTGCACCTCTGGCTGATGATTCCTCTGATTTTCAGTTTCACTTCTTGAAAAGT
GGTGGCCTACCCCTTGTACTGAGTATGCTAACCAGAAATAACTTCCTACCGAATGCAGAT
ATGGAAACTCGAAGGGGTGCCTACCTCAATGCTCTTAAAATAGCCAAGCTTTTGCTAACT
GCCATTGGCTATGGTCATGTTCGAGCTGTGGCAGAAGCTTGTCAGCCAGGTGTAGAAGGT
GTGAATCCCATGACACAGATCAACCAAGTTACCCATGATCAAGCAGTGGTGCTACAAAGT
GCCCTTCAGAGCATTCCTAATCCATCATCCGAGTGCATGCTTAGAAATGTGTCAGTTCGT
CTTGCTCAGCAGATATCTGATGAGGCTTCAAGATATATGCCTGATATTTGTGTAATTAGA
GCTATACAAAAAATTATCTGGGCATCAGGATGTGGGTCGTTACAGCTAGTATTTAGCCCA
AATGAAGAAATCACTAAAATTTATGAGAAGACCAATGCAGGCAATGAGCCAGACTTGGAA
GACGAACAGGTTTGCTGTGAAGCATTGGAAGTGATGACCTTATGTTTTGCCTTGATTCCA
ACAGCCTTAGATGCTCTTAGTAAAGAAAAGGCTTGGCAGACATTCATCATTGACTTACTA
TTGCACTGTCACAGCAAAACTGTTCGTCAGGTGGCACAGGAGCAGTTCTTTTTAATGTGC
ACCAGATGTTGCATGGGACACCGGCCTCTACTTTTCTTCATTACTCTACTCTTTACTGTT
TTGGGGAGCACAGCAAGAGAGAGAGCTAAACACTCAGGCGACTACTTTACTCTTTTAAGA
CACCTTCTTAATTACGCTTACAATAGTAATATTAATGTACCCAATGCTGAAGTTCTTCTC
AATAATGAAATTGATTGGCTTAAAAGAATTAGGGATGATGTTAAAAGAACAGGAGAAACG
GGTATTGAAGAGACGATCTTAGAGGGCCACCTTGGAGTGACAAAGGAGTTACTGGCCTTT
CAAACTTCTGAGAAAAAATTTCATATTGGTTGTGAAAAAGGAGGTGCTAATCTCATTAAA
GAATTAATTGATGATTTCATATTTCCTGCATCCAATGTTTACCTACAGTATATGAGAAAT
GGAGAGCTTCCAGCTGAACAGGCTATTCCGGTCTGTGGTTCACCACCTACAATTAATGCT
GGTTTTGAATTACTTGTAGCATTAGCTGTTGGCTGTGTGAGGAATCTCAAACAAATAGTA
GATTCTTTGACTGAAATGTATTACATTGGCACAGCAATAACTACTTGTGAAGCACTTACT
GAGTGGGAATATCTGCCACCTGTTGGACCCCGCCCACCCAAAGGATTCGTGGGGCTGAAA
AATGCCGGTGCTACTTGTTACATGAATTCTGTGATTCAGCAACTCTACATGATTCCTTCC
ATTAGGAACGGTATTCTTGCCATTGAAGGCACAGGTAGTGATGTAGATGATGATATGTCT
GGGGATGAGAAGCAGGACAATGAGAGCAATGTTGATCCCAGGGATGATGTATTTGGATAT
CCTCAACAATTTGAAGATAAACCAGCATTAAGTAAAACTGAAGATAGAAAAGAGTACAAC
ATTGGTGTCCTAAGACACCTTCAGGTCATCTTTGGTCATTTAGCTGCTTCTCGACTGCAA
TACTATGTGCCCAGAGGATTTTGGAAACAGTTCAGGCTTTGGGGTGAGCCTGTTAATCTG
CGTGAACAACACGATGCTTTAGAATTTTTTAATTCATTGGTGGATAGTTTAGATGAAGCT
TTAAAAGCTTTAGGACATCCAGCTATGCTAAGTAAAGTCTTAGGAGGTTCCTTTGCTGAT
CAGAAGATCTGCCAAGGCTGCCCACATAGGTACGAATGTGAAGAATCTTTTACGACCCTA
AACGTAGACATTAGAAATCACCAAAATCTTCTTGATTCTTTGGAACAGTATGTCAAAGGA
GATTTACTAGAAGGTGCAAATGCATATCATTGTGAAAAATGCAATAAAAAGGTTGATACC
GTAAAGCGCTTGCTGATTAAAAAATTACCTCCTGTTCTTGCTATACAACTAAAGCGATTT
GACTATGACTGGGAAAGAGAATGTGCAATCAAGTTCAATGATTATTTTGAATTTCCTCGA
GAGCTGGACATGGAACCTTACACAGTTGCAGGTGTCGCAAAGCTGGAAGGGGATAATGTA
AACCCAGAGAGTCAGTTGATACAACAGAGTGAGCAGTCTGAAAGTGAGACAGCAGGAAGC
ACAAAATACAGACTTGTGGGTGTGCTCGTACACAGTGGTCAAGCGAGTGGGGGGCATTAT
TATTCTTACATCATCCAAAGGAATGGTGGAGATGGTGAGAGAAATCGCTGGTATAAATTT
GATGATGGTGATGTAACAGAATGTAAAATGGATGATGACGAAGAAATGAAAAACCAGTGT
TTTGGTGGAGAGTACATGGGAGAAGTGTTTGATCACATGATGAAGCGTATGTCATACAGG
CGCCAGAAAAGGTGGTGGAATGCTTATATACTTTTTTATGAACGAATGGACACAATAGAC
CAAGATGATGAGTTGATAAGATATATATCAGAGCTTGCTATCACCACCAGACCTCATCAG
ATTATTATGCCATCAGCCATTGAGAGAAGTGTACGGAAACAGAACGTACAATTCATGCAT
AACCGAATGCAGTACAGTATGGAGTATTTTCAGTTTATGAAAAAACTGCTTACATGTAAT
GGCGTTTACTTAAACCCTCCTCCCGGGCAAGATCACCTGTTGCCTGAAGCAGAAGAAATC
ACTATGATCAGTATTCAACTTGCTGCTAGGTTCCTCTTTACTACAGGATTTCACACAAAG
AAAGTAGTCCGTGGCTCTGCCAGTGATTGGTATGATGCATTGTGTATTCTCCTTCGTCAC
AGCAAGAATGTACGTTTTTGGTTTGCTCATAACGTCCTTTTTAATGTTTCAAATCGCTTC
TCCGAATACCTTCTGGAGTGCCCTAGTGCAGAAGTGAGGGGTGCGTTTGCAAAACTTATA
GTCTTTATTGCACATTTTTCCTTGCAAGATGGGCCATGTCCTTCACCTTTTGCCTCTCCT
GGACCTTCTAGTCAGGCTTATGACAACTTAAGCTTGAGTGATCACTTACTAAGAGCAGTA
CTAAATCTCTTGAGAAGGGAAGTTTCAGAGCATGGGCGTCATTTACAGCAGTATTTCAAC
CTGTTTGTAATGTATGCCAATTTAGGTGTGGCAGAGAAGACACAGCTTCTGAAATTGAGT
GTACCTGCTACTTTTATGCTTGTGTCTTTAGATGAAGGTCCAGGTCCTCCAATCAAATAC
CAGTATGCTGAATTAGGCAAATTATACTCAGTAGTGTCACAGCTGATCCGCTGTTGCAAT
GTCTCTTCAAGAATGCAGTCTTCAATCAATGGTAATCCTCCTCTTCCCAATCCTTTTGGT
GATCCTAATTTATCACAACCTATAATGCCAATTCAGCAGAATGTGGCAGACATTTTATTT
GTGAGAACAAGTTATGTGAAGAAAATCATTGAAGACTGCAGTAATTCAGAGGAAACCGTC
AAATTGCTTCGTTTTTGCTGCTGGGAGAATCCTCAGTTCTCATCTACTGTCCTCAGTGAA
CTTCTCTGGCAGGTTGCATATTCCTATACCTATGAACTGCGGCCCTATTTGGATCTGCTT
TTGCAAATCTTACTGATTGAGGACTCCTGGCAAACTCACAGAATTCATAATGCACTGAAA
GGAATTCCAGATGACCGAGATGGGCTGTTTGACACAATCCAGCGCTCTAAGAATCACTAT
CAAAAAAGAGCATACCAGTGTATAAAATGTATGGTAGCTCTATTTAGTAACTGTCCTGTT
GCTTACCAAATCCTGCAGGGCAATGGAGATCTTAAAAGAAAGTGGACCTGGGCAGTGGAA
TGGCTTGGAGATGAACTTGAAAGAAGACCATATACTGGCAATCCTCAGTACACTTACAAC
AATTGGTCTCCCCCAGTGCAAAGCAATGAAACGTCCAATGGTTATTTCTTGGAGAGATCA
CATAGTGCTAGGATGACACTTGCAAAAGCTTGTGAACTCTGTCCAGAGGAGGAGCCAGAT
GACCAAGATGCTCCAGATGAACATGAGTCGCCTCCACCTGAAGATGCCCCATTGTACCCC
CATTCACCTGGATCTCAGTATCAACAGAATAACCATGTGCATGGACAGCCATATACAGGC
CCAGCAGCACATCACATGAACAACCCTCAGAGAACTGGCCAACGAGCACAAGAAAATTAT
GAAGGCAGTGAAGAAGTATCCCCACCTCAAACCAAGGATCAATGA
Protein Properties
Number of Residues 2547
Molecular Weight 289538.0
Theoretical pI 5.51
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Probable ubiquitin carboxyl-terminal hydrolase FAF-X
MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQL
EDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVKSEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHVSLVELCVAKLSQDWFPLLELLAMALNPHCKFHIY
NGTRPCESVSSSVQLPEDELFARSPDPRSPKGWLVDLLNKFGTLNGFQILHDRFINGSAL
NVQIIAALIKPFGQCYEFLTLHTVKKYFLPIIEMVPQFLENLTDEELKKEAKNEAKNDAL
SMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNKVISSVSY
YTHRHGNPEEEEWLTAERMAEWIQQNNILSIVLRDSLHQPQYVEKLEKILRFVIKEKALT
LQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNASKKQREKL
LELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDLALSAHIKILDYSCSQDRDTQ
KIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRHDLINQLQ
HNHALVTLVAENLATYMESMRLYARDHEDYDPQTVRLGSRYSHVQEVQERLNFLRFLLKD
GQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFFESNVLQL
DPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQSNDDIAS
RAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCVLDGDKDSVNCARQEA
VRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHLSFVVRFPNQGRQVDDLEVWSH
TNDTIGSVRRCILNRIKANVAHTKIELFVGGELIDPADDRKLIGQLNLKDKSLITAKLTQ
ISSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGVIMSLHPRYISFLWQVADL
GSSLNMPPLRDGARVLMKLMPPDSTTIEKLRAICLDHAKLGESSLSPSLDSLFFGPSASQ
VLYLTEVVYALLMPAGAPLADDSSDFQFHFLKSGGLPLVLSMLTRNNFLPNADMETRRGA
YLNALKIAKLLLTAIGYGHVRAVAEACQPGVEGVNPMTQINQVTHDQAVVLQSALQSIPN
PSSECMLRNVSVRLAQQISDEASRYMPDICVIRAIQKIIWASGCGSLQLVFSPNEEITKI
YEKTNAGNEPDLEDEQVCCEALEVMTLCFALIPTALDALSKEKAWQTFIIDLLLHCHSKT
VRQVAQEQFFLMCTRCCMGHRPLLFFITLLFTVLGSTARERAKHSGDYFTLLRHLLNYAY
NSNINVPNAEVLLNNEIDWLKRIRDDVKRTGETGIEETILEGHLGVTKELLAFQTSEKKF
HIGCEKGGANLIKELIDDFIFPASNVYLQYMRNGELPAEQAIPVCGSPPTINAGFELLVA
LAVGCVRNLKQIVDSLTEMYYIGTAITTCEALTEWEYLPPVGPRPPKGFVGLKNAGATCY
MNSVIQQLYMIPSIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDDVFGYPQQFEDK
PALSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPVNLREQHDAL
EFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFTTLNVDIRNH
QNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRFDYDWERE
CAIKFNDYFEFPRELDMEPYTVAGVAKLEGDNVNPESQLIQQSEQSESETAGSTKYRLVG
VLVHSGQASGGHYYSYIIQRNGGDGERNRWYKFDDGDVTECKMDDDEEMKNQCFGGEYMG
EVFDHMMKRMSYRRQKRWWNAYILFYERMDTIDQDDELIRYISELAITTRPHQIIMPSAI
ERSVRKQNVQFMHNRMQYSMEYFQFMKKLLTCNGVYLNPPPGQDHLLPEAEEITMISIQL
AARFLFTTGFHTKKVVRGSASDWYDALCILLRHSKNVRFWFAHNVLFNVSNRFSEYLLEC
PSAEVRGAFAKLIVFIAHFSLQDGPCPSPFASPGPSSQAYDNLSLSDHLLRAVLNLLRRE
VSEHGRHLQQYFNLFVMYANLGVAEKTQLLKLSVPATFMLVSLDEGPGPPIKYQYAELGK
LYSVVSQLIRCCNVSSRMQSSINGNPPLPNPFGDPNLSQPIMPIQQNVADILFVRTSYVK
KIIEDCSNSEETVKLLRFCCWENPQFSSTVLSELLWQVAYSYTYELRPYLDLLLQILLIE
DSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSNCPVAYQILQG
NGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPVQSNETSNGYFLERSHSARMTL
AKACELCPEEEPDDQDAPDEHESPPPEDAPLYPHSPGSQYQQNNHVHGQPYTGPAAHHMN
NPQRTGQRAQENYEGSEEVSPPQTKDQ
GenBank ID Protein 145309311
UniProtKB/Swiss-Prot ID Q93008
UniProtKB/Swiss-Prot Entry Name USP9X_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001039591
GeneCard ID USP9X
GenAtlas ID USP9X
HGNC ID HGNC:12632
References
General References
  1. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  8. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  9. Tang LY, Deng N, Wang LS, Dai J, Wang ZL, Jiang XS, Li SJ, Li L, Sheng QH, Wu DQ, Li L, Zeng R: Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction. Mol Cell Proteomics. 2007 Nov;6(11):1952-67. Epub 2007 Aug 12. [PubMed:17693683 ]
  10. Al-Hakim AK, Zagorska A, Chapman L, Deak M, Peggie M, Alessi DR: Control of AMPK-related kinases by USP9X and atypical Lys(29)/Lys(33)-linked polyubiquitin chains. Biochem J. 2008 Apr 15;411(2):249-60. doi: 10.1042/BJ20080067. [PubMed:18254724 ]
  11. Dupont S, Mamidi A, Cordenonsi M, Montagner M, Zacchigna L, Adorno M, Martello G, Stinchfield MJ, Soligo S, Morsut L, Inui M, Moro S, Modena N, Argenton F, Newfeld SJ, Piccolo S: FAM/USP9x, a deubiquitinating enzyme essential for TGFbeta signaling, controls Smad4 monoubiquitination. Cell. 2009 Jan 9;136(1):123-35. doi: 10.1016/j.cell.2008.10.051. [PubMed:19135894 ]
  12. Jones MH, Furlong RA, Burkin H, Chalmers IJ, Brown GM, Khwaja O, Affara NA: The Drosophila developmental gene fat facets has a human homologue in Xp11.4 which escapes X-inactivation and has related sequences on Yq11.2. Hum Mol Genet. 1996 Nov;5(11):1695-701. [PubMed:8922996 ]
  13. Vong QP, Cao K, Li HY, Iglesias PA, Zheng Y: Chromosome alignment and segregation regulated by ubiquitination of survivin. Science. 2005 Dec 2;310(5753):1499-504. [PubMed:16322459 ]