You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10475
Secondary Accession Numbers
  • 16588
Name Casein kinase 2 beta polypeptide
Synonyms
  1. SubName: Casein kinase 2, beta polypeptide
  2. SubName: Casein kinase 2, beta polypeptide, isoform CRA_b
  3. SubName: cDNA, FLJ92126, Homo sapiens casein kinase 2, beta polypeptide (CSNK2B), mRNA
Gene Name CSNK2B
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase regulator activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
protein kinase ck2 complex
Function
enzyme regulator activity
kinase regulator activity
protein kinase regulator activity
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:6
Locus 6p21-p12|6p21.3
SNPs CSNK2B
Gene Sequence
>648 bp
ATGAGCAGCTCAGAGGAGGTGTCCTGGATTTCCTGGTTCTGTGGGCTCCGTGGCAATGAA
TTCTTCTGTGAAGTGGATGAAGACTACATCCAGGACAAATTTAATCTTACTGGACTCAAT
GAGCAGGTCCCTCACTACCGACAAGCTCTAGACATGATCTTGGACCTGGAGCCTGATGAA
GAACTGGAAGACAACCCCAACCAGAGTGACCTGATTGAGCAGGCAGCCGAGATGCTTTAT
GGATTGATCCACGCCCGCTACATCCTTACCAACCGTGGCATCGCCCAGATGTTGGAAAAG
TACCAGCAAGGAGACTTTGGTTACTGTCCTCGTGTGTACTGTGAGAACCAGCCAATGCTT
CCCATTGGCCTTTCAGACATCCCAGGTGAAGCCATGGTGAAGCTCTACTGCCCCAAGTGC
ATGGATGTGTACACACCCAAGTCATCAAGACACCATCACACGGATGGCGCCTACTTCGGC
ACTGGTTTCCCTCACATGCTCTTCATGGTGCATCCCGAGTACCGGCCCAAGAGACCTGCC
AACCAGTTTGTGCCCAGGCTCTACGGTTTCAAGATCCATCCGATGGCCTACCAGCTGCAG
CTCCAAGCCGCCAGCAACTTCAAGAGCCCAGTCAAGACGATTCGCTGA
Protein Properties
Number of Residues 215
Molecular Weight 24942.2
Theoretical pI 5.29
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Casein kinase 2 beta polypeptide
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
GenBank ID Protein 189053179
UniProtKB/Swiss-Prot ID P67870
UniProtKB/Swiss-Prot Entry Name B0UXA9_HUMAN
PDB IDs
GenBank Gene ID AK311860
GeneCard ID CSNK2B
GenAtlas ID CSNK2B
HGNC ID HGNC:2460
References
General References Not Available