You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10643
Secondary Accession Numbers
  • 16873
Name Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16
Synonyms
  1. ATP-dependent RNA helicase #3
  2. DEAH-box protein 16
Gene Name DHX16
Protein Type Enzyme
Biological Properties
General Function Involved in nucleic acid binding
Specific Function Probable ATP-binding RNA helicase involved in pre-mRNA splicing.
Pathways
  • Spliceosome
Reactions
Adenosine triphosphate + Water → ADP + Phosphoric acid details
GO Classification
Biological Process
mRNA processing
RNA splicing
Cellular Component
nucleus
Function
binding
catalytic activity
hydrolase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
atp-dependent helicase activity
atpase activity
atpase activity, coupled
nucleic acid binding
nucleoside-triphosphatase activity
helicase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Molecular Function
nucleic acid binding
RNA helicase activity
ATP binding
ATP-dependent helicase activity
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location 6
Locus 6p21.3
SNPs DHX16
Gene Sequence
>3126 bp
ATGGCGACGCCGGCGGGTCTGGAGCGCTGGGTTCAGGACGAGCTGCACTCGGTGTTGGGG
CTGAGCGAGCGGCACGTCGCCCAGTTTCTGATCGGTACCGCACAGCGCTGCACCTCTGCC
GAGGAGTTCGTGCAGCGCCTACGAGACACTGATACCTTGGATCTCAGTGGGCCGGCCCGG
GACTTCGCCCTGAGACTCTGGAACAAGGTACCACGAAAGGCAGTGGTAGAAAAGCCAGCT
CGGGCAGCAGAGCGAGAGGCCCGGGCCCTGCTGGAGAAGAACCGATCTTATAGGTTACTG
GAAGACAGTGAAGAGAGCAGTGAGGAGACTGTGAGTAGGGCTGGAAGCAGCCTCCAGAAG
AAACGTAAAAAGCGGAAACACCTCAGGAAGAAGCGTGAGGAAGAAGAGGAGGAAGAGGCT
TCTGAGAAAGGGAAGAAGAAAACAGGGGGGAGTAAACAGCAGACAGAGAAGCCAGAGTCG
GAAGATGAGTGGGAACGGACAGAGCGTGAACGCCTTCAGGACCTGGAGGAGCGTGATGCC
TTTGCTGAGCGGGTTCGACAGCGGGACAAGGATCGGACTCGAAATGTCCTGGAACGGTCA
GACAAGAAGGCTTATGAAGAGGCTCAGAAGCGCCTCAAGATGGCCGAGGAAGACCGGAAG
GCCATGATCCCTGAGCTGCGGAAGAAATCTCGCCGAGAGTACCTGGCTAAGCGGGAGCGA
GAGAAGCTTGAGGACCTGGAGGCGGAGCTGGCTGATGAGGAGTTCCTTTTTGGGGACGTG
GAGCTGAGCCGGCACGAGCGGCAGGAGCTCAAATATAAGCGGCGAGTGCGGGATCTCGCC
CGGGAGTACCGGGCAGCTGGGGAGCAGGAGAAGCTGGAGGCCACCAATCGCTACCACATG
CCCAAGGAAACCCGAGGACAGCCAGCCCGAGCTGTGGATCTAGTGGAGGAGGAATCAGGA
GCCCCTGGGGAGGAGCAGCGGCGCTGGGAGGAGGCGCGGCTTGGGGCAGCGTCCCTGAAG
TTTGGGGCCCGAGATGCTGCCTCTCAGGAGCCCAAGTATCAACTGGTGCTGGAGGAGGAG
GAGACCATTGAGTTTGTCCGGGCCACTCAGCTCCAGGGTGATGAGGAGCCGTCAGCTCCA
CCCACTTCAACTCAGGCCCAGCAGAAAGAGTCCATCCAGGCCGTCCGCCGCAGCCTCCCG
GTGTTCCCATTTCGAGAGGAGCTCCTGGCTGCTATTGCAAATCACCAAGTCCTCATCATT
GAAGGCGAGACAGGCTCAGGGAAGACCACCCAGATCCCGCAGTATCTCTTTGAGGAGGGT
TATACAAACAAGGGTATGAAGATTGCCTGCACCCAACCCCGGAGAGTGGCTGCCATGAGT
GTGGCCGCCCGAGTGGCCCGGGAGATGGGTGTGAAGCTTGGGAATGAGGTTGGCTACAGC
ATCCGCTTTGAGGACTGCACATCAGAGCGAACTGTCCTCCGCTACATGACAGATGGGATG
CTTCTCCGGGAGTTCCTCTCTGAGCCTGACCTGGCGAGTTACAGCGTGGTGATGGTGGAT
GAGGCACACGAAAGGACCCTACACACAGACATTCTCTTTGGATTGATCAAGGATGTTGCT
CGCTTCCGACCTGAGCTCAAGGTCCTGGTGGCTTCAGCCACAATGGACACTGCCCGTTTT
TCCACCTTCTTTGATGACGCCCCTGTGTTTCGAATCCCCGGACGCAGGTTTCCTGTGGAC
ATCTTCTACACCAAGGCTCCAGAGGCTGACTACTTGGAAGCTTGTGTAGTATCTGTGTTG
CAGATCCATGTGACCCAGCCCCCTGGGGATATCCTGGTGTTCCTGACAGGACAGGAGGAG
ATTGAGGCTGCCTGTGAGATGCTCCAGGATCCCTGCCGCCGCCTGGGCTCCAAAATCCGG
GAGCTCCTGGTGCTGCCCATTTATGCCAATCTGCCCTCTGACATGCAGGCCCGTATCTTC
CAGCCCACACCACCTGGGGCACGAAAGGTGGTTGTGGCAACGAACATTGCTGAGACATCA
CCCACCATTGAGGGCATCATTTATGTGCTGGATCCAGGGTTCTGTAAGCAGAAGAGCTAC
AACCCCCGCACAGGCATGGAATCGCTCACTGTCACACCCTGCAGCAAGGCCTCAGCCAAT
CAGCGAGCTGGCAGGGCAGGTCGGGTGGCTGCAGGGAAGTGCTTCCGCCTGTATACCGCC
TGGGCCTATCAGCACGAGCTTGAGGAAACCACAGTGCCTGAGATCCAGAGGACCAGCTTG
GGCAATGTCGTGTTGCTGCTCAAGAGCTTAGGGATCCATGACCTAATGCACTTTGATTTC
CTGGACCCTCCACCATATGAGACACTGCTGCTGACTTTGGAGCAGCTGTATGCTCTGGGA
GCCCTCAACCACCTTGGGGAGCTCACCACGTCTGGTCGAAAGATGGCAGAGCTGCCGGTG
GACCCCATGCTGTCCAAAATGATCTTAGCCTCTGAGAAGTACAGCTGTTCAGAGGAGATC
CTGACAGTGGCTGCCATGCTCTCTGTCAACAACTCCATCTTCTACCGACCAAAGGACAAG
GTCGTCCATGCTGACAATGCCCGTGTCAACTTCTTTCTCCCTGGCGGTGACCACCTGGTT
CTGCTAAATGTTTACACACAGTGGGCTGAGAGTGGTTACTCTTCCCAGTGGTGCTGTGAG
AACTTTGTACAGTTCAGATCGATGCGCCGAGCCCGGGATGTGCGGGAACAGCTGGAAGGG
CTCTTGGAACGTGTGGAAGTTGGTCTCAGTTCCTGCCAGGGGGACTATATCCGTGTACGC
AAGGCCATCACTGCTGGTTACTTTTACCACACGGCACGGTTGACTCGGAGTGGCTACCGC
ACAGTGAAACAGCAGCAGACAGTCTTCATTCATCCCAACTCCTCCCTCTTTGAGCAACAG
CCACGCTGGCTGCTCTACCACGAACTTGTCTTGACCACCAAAGAGTTCATGAGACAGGTA
CTGGAGATTGAGAGCAGTTGGCTTCTGGAGGTGGCTCCCCATTATTATAAGGCCAAGGAG
CTAGAAGATCCCCATGCTAAGAAAATGCCCAAAAAAATAGGCAAAACACGAGAAGAGCTA
GGGTAA
Protein Properties
Number of Residues 1041
Molecular Weight 112453.87
Theoretical pI 6.92
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16
MATPAGLERWVQDELHSVLGLSERHVAQFLIGTAQRCTSAEEFVQRLRDTDTLDLSGPAR
DFALRLWNKVPRKAVVEKPARAAEREARALLEKNRSYRLLEDSEESSEETVSRAGSSLQK
KRKKRKHLRKKREEEEEEEASEKGKKKTGGSKQQTEKPESEDEWERTERERLQDLEERDA
FAERVRQRDKDRTRNVLERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKRER
EKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEKLEATNRYHM
PKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEE
ETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLII
EGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYS
IRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVA
RFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVL
QIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIF
QPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASAN
QRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDF
LDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEI
LTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYE
NFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYR
TVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKE
LEDPHAKKMPKKIGKTREELG
GenBank ID Protein 3107913
UniProtKB/Swiss-Prot ID O60231
UniProtKB/Swiss-Prot Entry Name DHX16_HUMAN
PDB IDs Not Available
GenBank Gene ID AB001601
GeneCard ID DHX16
GenAtlas ID DHX16
HGNC ID HGNC:2739
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  9. Han G, Ye M, Zhou H, Jiang X, Feng S, Jiang X, Tian R, Wan D, Zou H, Gu J: Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography. Proteomics. 2008 Apr;8(7):1346-61. doi: 10.1002/pmic.200700884. [PubMed:18318008 ]
  10. Nagase T, Ishikawa K, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Feb 28;5(1):31-9. [PubMed:9628581 ]
  11. Imamura O, Saiki K, Tani T, Ohshima Y, Sugawara M, Furuichi Y: Cloning and characterization of a human DEAH-box RNA helicase, a functional homolog of fission yeast Cdc28/Prp8. Nucleic Acids Res. 1998 May 1;26(9):2063-8. [PubMed:9547260 ]