Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10646
Secondary Accession Numbers
  • 16882
Name Gamma-aminobutyric acid receptor-associated protein-like 2
Synonyms
  1. GABA(A) receptor-associated protein-like 2
  2. GATE-16
  3. GEF-2
  4. Ganglioside expression factor 2
  5. General protein transport factor p16
  6. Golgi-associated ATPase enhancer of 16 kDa
  7. MAP1 light chain 3-related protein
Gene Name GABARAPL2
Protein Type Enzyme
Biological Properties
General Function Involved in ATPase binding
Specific Function Involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Golgi apparatus
Gene Properties
Chromosome Location Chromosome:1
Locus 16q22.1
SNPs GABARAPL2
Gene Sequence
>354 bp
ATGAAGTGGATGTTCAAGGAGGACCACTCGCTGGAACACAGATGCGTGGAGTCCGCGAAG
ATTCGAGCGAAATATCCCGACAGGGTTCCGGTGATTGTGGAAAAGGTCTCAGGCTCTCAG
ATTGTTGACATTGACAAACGGAAGTACTTGGTTCCATCTGATATCACTGTGGCTCAGTTC
ATGTGGATCATCAGGAAAAGGATCCAGCTTCCTTCTGAAAAGGCGATCTTCCTGTTTGTG
GATAAGACAGTCCCACAGTCCAGCCTAACTATGGGACAGCTTTACGAGAAGGAAAAAGAT
GAAGATGGATTCTTATATGTGGCCTACAGCGGAGAGAACACTTTTGGCTTCTGA
Protein Properties
Number of Residues 117
Molecular Weight 13666.7
Theoretical pI 8.43
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Gamma-aminobutyric acid receptor-associated protein-like 2
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
GenBank ID Protein 12641849
UniProtKB/Swiss-Prot ID P60520
UniProtKB/Swiss-Prot Entry Name GBRL2_HUMAN
PDB IDs
GenBank Gene ID AB030710
GeneCard ID GABARAPL2
GenAtlas ID GABARAPL2
HGNC ID HGNC:13291
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  4. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  5. Okazaki N, Yan J, Yuasa S, Ueno T, Kominami E, Masuho Y, Koga H, Muramatsu M: Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain: possible role of vesicular transport in axonal elongation. Brain Res Mol Brain Res. 2000 Dec 28;85(1-2):1-12. [PubMed:11146101 ]
  6. Xin Y, Yu L, Chen Z, Zheng L, Fu Q, Jiang J, Zhang P, Gong R, Zhao S: Cloning, expression patterns, and chromosome localization of three human and two mouse homologues of GABA(A) receptor-associated protein. Genomics. 2001 Jun 15;74(3):408-13. [PubMed:11414770 ]