You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10654
Secondary Accession Numbers
  • 16891
Name 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2
Synonyms Not Available
Gene Name OGFOD2
Protein Type Enzyme
Biological Properties
General Function Involved in iron ion binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
l-ascorbic acid binding
iron ion binding
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
vitamin binding
oxidoreductase activity
Process
metabolic process
oxidation reduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 12q24.31
SNPs OGFOD2
Gene Sequence
>1053 bp
ATGGCGACGGTGGGGGCTCCGCGGCACTTCTGCCGCTGCGCCTGCTTCTGCACCGATAAC
TTGTACGTGGCGCGCTATGGGCTGCACGTGCGCTTCCGAGGCGAGCAGCAGCTGCGCCGG
GACTACGGCCCGATCCTGCGCAGCCGAGGCTGTGTTAGCGCCAAGGACTTCCAGCAGCTG
TTAGCAGAGCTTGAGCAGGAGGTGGAGCGGCGGCAGCGGCTGGGGCAGGAGTCAGCAGCT
AGGAAAGCCCTCATCGCGAGTTCCTACCACCCGGCACGGCCTGAGGTCTACGACTCACTG
CAGGATGCAGCTCTGGCCCCCGAGTTCCTGGCCGTGACTGAGTACAGCGTGTCCCCAGAC
GCAGACCTCAAGGGCCTTCTCCAGCGGCTGGAGACAGTATCGGAGGAGAAGCGCATCTAC
CGGGTGCCTGTTTTCACAGCGCCCTTCTGCCAGGCCCTGCTGGAAGAGCTGGAGCACTTC
GAGCAATCGGACATGCCTAAGGGGAGGCCCAACACCATGAACAACTACGGGGTGCTGCTG
CACGAGCTCGGGCTGGACGAGCCGCTGATGACACCACTGCGGGAGCGCTTCCTGCAGCCG
CTGATGGCCCTGCTGTACCCTGACTGTGGCGGGGGCCGGCTCGACAGCCACCGGGCCTTT
GTGGTCAAATACGCACCGGGCCAGGACCTGGAGCTGGGCTGCCACTATGATAATGCCGAG
CTCACCCTCAATGTGGCCTTGGGCAAGGTCTTCACAGGGGGCGCCCTGTATTTTGGGGGC
CTCTTCCAGGCACCCACAGCCCTGACGGAGCCCCTGGAGGTGGAGCACGTGGTGGGCCAG
GGTGTCCTCCACCGTGGCGGCCAGCTGCATGGAGCCCGGCCCTTGGGCACTGGTGAGCGT
TGGAACCTTGTCGTCTGGCTCCGAGCCTCTGCTGTGCGCAACAGCCTCTGTCCCATGTGC
TGCCGTGAGCCCGACCTGGTGGACGATGAGGGCTTCGGTGATGGCTTCACCCGAGAGGAG
CCCGCCACGGTGGATGTATGTGCGCTCACCTGA
Protein Properties
Number of Residues 350
Molecular Weight 38996.1
Theoretical pI 5.44
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2
MATVGAPRHFCRCACFCTDNLYVARYGLHVRFRGEQQLRRDYGPILRSRGCVSAKDFQQL
LAELEQEVERRQRLGQESAARKALIASSYHPARPEVYDSLQDAALAPEFLAVTEYSVSPD
ADLKGLLQRLETVSEEKRIYRVPVFTAPFCQALLEELEHFEQSDMPKGRPNTMNNYGVLL
HELGLDEPLMTPLRERFLQPLMALLYPDCGGGRLDSHRAFVVKYAPGQDLELGCHYDNAE
LTLNVALGKVFTGGALYFGGLFQAPTALTEPLEVEHVVGQGVLHRGGQLHGARPLGTGER
WNLVVWLRASAVRNSLCPMCCREPDLVDDEGFGDGFTREEPATVDVCALT
GenBank ID Protein 193787733
UniProtKB/Swiss-Prot ID Q6N063
UniProtKB/Swiss-Prot Entry Name OGFD2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK094820
GeneCard ID OGFOD2
GenAtlas ID OGFOD2
HGNC ID HGNC:25823
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]