You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10673
Secondary Accession Numbers
  • 16931
Name Peptidyl-prolyl cis-trans isomerase FKBP5
Synonyms
  1. 51 kDa FK506-binding protein
  2. 51 kDa FKBP
  3. 54 kDa progesterone receptor-associated immunophilin
  4. Androgen-regulated protein 6
  5. FF1 antigen
  6. FK506-binding protein 5
  7. FKBP-5
  8. FKBP-51
  9. FKBP54
  10. HSP90-binding immunophilin
  11. PPIase FKBP5
  12. Rotamase
  13. p54
Gene Name FKBP5
Protein Type Enzyme
Biological Properties
General Function Involved in protein folding
Specific Function Interacts with functionally mature heterooligomeric progesterone receptor complexes along with HSP90 and TEBP
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
Process
metabolic process
macromolecule metabolic process
cellular protein metabolic process
protein folding
protein metabolic process
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:6
Locus 6p21.31
SNPs FKBP5
Gene Sequence
>1374 bp
ATGACTACTGATGAAGGTGCCAAGAACAATGAAGAAAGCCCCACAGCCACTGTTGCTGAG
CAGGGAGAGGATATTACCTCCAAAAAAGACAGGGGAGTATTAAAGATTGTCAAAAGAGTG
GGGAATGGTGAGGAAACGCCGATGATTGGAGACAAAGTTTATGTCCATTACAAAGGAAAA
TTGTCAAATGGAAAGAAGTTTGATTCCAGTCATGATAGAAATGAACCATTTGTCTTTAGT
CTTGGCAAAGGCCAAGTCATCAAGGCATGGGACATTGGGGTGGCTACCATGAAGAAAGGA
GAGATATGCCATTTACTGTGCAAACCAGAATATGCATATGGCTCGGCTGGCAGTCTCCCT
AAAATTCCCTCGAATGCAACTCTCTTTTTTGAGATTGAGCTCCTTGATTTCAAAGGAGAG
GATTTATTTGAAGATGGAGGCATTATCCGGAGAACCAAACGGAAAGGAGAGGGATATTCA
AATCCAAACGAAGGAGCAACAGTAGAAATCCACCTGGAAGGCCGCTGTGGTGGAAGGATG
TTTGACTGCAGAGATGTGGCATTCACTGTGGGCGAAGGAGAAGACCACGACATTCCAATT
GGAATTGACAAAGCTCTGGAGAAAATGCAGCGGGAAGAACAATGTATTTTATATCTTGGA
CCAAGATATGGTTTTGGAGAGGCAGGGAAGCCTAAATTTGGCATTGAACCTAATGCTGAG
CTTATATATGAAGTTACACTTAAGAGCTTCGAAAAGGCCAAAGAATCCTGGGAGATGGAT
ACCAAAGAAAAATTGGAGCAGGCTGCCATTGTCAAAGAGAAGGGAACCGTATACTTCAAG
GGAGGCAAATACATGCAGGCGGTGATTCAGTATGGGAAGATAGTGTCCTGGTTAGAGATG
GAATATGGTTTATCAGAAAAGGAATCGAAAGCTTCTGAATCATTTCTCCTTGCTGCCTTT
CTGAACCTGGCCATGTGCTACCTGAAGCTTAGAGAATACACCAAAGCTGTTGAATGCTGT
GACAAGGCCCTTGGACTGGACAGTGCCAATGAGAAAGGCTTGTATAGGAGGGGTGAAGCC
CAGCTGCTCATGAACGAGTTTGAGTCAGCCAAGGGTGACTTTGAGAAAGTGCTGGAAGTA
AACCCCCAGAATAAGGCTGCAAGACTGCAGATCTCCATGTGCCAGAAAAAGGCCAAGGAG
CACAACGAGCGGGACCGCAGGATATACGCCAACATGTTCAAGAAGTTTGCAGAGCAGGAT
GCCAAGGAAGAGGCCAATAAAGCAATGGGCAAGAAGACTTCAGAAGGGGTCACTAATGAA
AAAGGAACAGACAGTCAAGCAATGGAAGAAGAGAAACCTGAGGGCCACGTATGA
Protein Properties
Number of Residues 457
Molecular Weight 51211.8
Theoretical pI 5.66
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Peptidyl-prolyl cis-trans isomerase FKBP5
MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGK
LSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLP
KIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRM
FDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAE
LIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD
AKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
GenBank ID Protein 17998669
UniProtKB/Swiss-Prot ID Q13451
UniProtKB/Swiss-Prot Entry Name FKBP5_HUMAN
PDB IDs
GenBank Gene ID AF194172
GeneCard ID FKBP5
GenAtlas ID FKBP5
HGNC ID HGNC:3721
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  5. Baughman G, Wiederrecht GJ, Chang F, Martin MM, Bourgeois S: Tissue distribution and abundance of human FKBP51, and FK506-binding protein that can mediate calcineurin inhibition. Biochem Biophys Res Commun. 1997 Mar 17;232(2):437-43. [PubMed:9125197 ]
  6. Nair SC, Rimerman RA, Toran EJ, Chen S, Prapapanich V, Butts RN, Smith DF: Molecular cloning of human FKBP51 and comparisons of immunophilin interactions with Hsp90 and progesterone receptor. Mol Cell Biol. 1997 Feb;17(2):594-603. [PubMed:9001212 ]
  7. Smith DF, Albers MW, Schreiber SL, Leach KL, Deibel MR Jr: FKBP54, a novel FK506-binding protein in avian progesterone receptor complexes and HeLa extracts. J Biol Chem. 1993 Nov 15;268(32):24270-3. [PubMed:7693698 ]
  8. Sinars CR, Cheung-Flynn J, Rimerman RA, Scammell JG, Smith DF, Clardy J: Structure of the large FK506-binding protein FKBP51, an Hsp90-binding protein and a component of steroid receptor complexes. Proc Natl Acad Sci U S A. 2003 Feb 4;100(3):868-73. Epub 2003 Jan 21. [PubMed:12538866 ]