You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10725
Secondary Accession Numbers
  • 16987
Name Protein amnionless
Synonyms Not Available
Gene Name AMN
Protein Type Transporter
Biological Properties
General Function Involved in multicellular organismal development
Specific Function Necessary for efficient absorption of vitamin B12. May direct the production of trunk mesoderm during development by modulating a bone morphogenetic protein (BMP) signaling pathway in the underlying visceral endoderm
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 14q32.3
SNPs AMN
Gene Sequence
>1362 bp
ATGGGCGTCCTGGGCCGGGTCCTGCTGTGGCTGCAGCTCTGCGCACTGACCCAGGCGGTC
TCCAAACTCTGGGTCCCCAACACGGACTTCGACGTCGCAGCCAACTGGAGCCAGAACCGG
ACCCCGTGCGCCGGCGGCGCCGTTGAGTTCCCGGCGGACAAGATGGTGTCAGTCCTGGTG
CAAGAAGGTCACGCCGTCTCAGACATGCTCCTGCCGCTGGATGGGGAACTCGTCCTGGCT
TCAGGAGCCGGATTCGGCGTCTCAGACGTGGGCTCGCACCTGGACTGTGGCGCGGGCGAA
CCTGCCGTCTTCCGCGACTCTGACCGCTTCTCCTGGCATGACCCGCACCTGTGGCGCTCT
GGGGACGAGGCACCTGGCCTCTTCTTCGTGGACGCCGAGCGCGTGCCCTGCCGCCACGAC
GACGTCTTCTTTCCGCCTAGTGCCTCCTTCCGCGTGGGGCTCGGCCCTGGCGCTAGCCCC
GTGCGTGTCCGCAGCATCTCGGCTCTGGGCCGGACGTTCACGCGCGACGAGGACCTGGCT
GTTTTCCTGGCGTCCCGCGCGGGCCGCCTACGCTTCCACGGGCCGGGCGCGCTGAGCGTG
GGCCCCGAGGACTGCGCGGACCCGTCGGGCTGCGTCTGCGGCAACGCGGAGGCGCAGCCG
TGGATCTGCGCGGCCCTGCTCCAGCCCCTGGGCGGCCGCTGTCCCCAGGCCGCCTGCCAC
TTTGCCCTCCGGCCCCAGGGGCAGTGCTGTGACCTCTGTGGAGCCGTTGTGTTGCTGACC
CACGGCCCCGCATTTGACCTGGAGCGGTACCGGGCGCGGATACTGGACACCTTCCTGGGT
CTGCCTCAGTACCACGGGCTGCAGGTGGCCGTGTCCAAGGTGCCACGCTCGTCCCGGCTC
CGTGAGGCCGATACGGAGATCCAGGTGGTGCTGGTGGAGAATGGGCCCGAGACAGGCGGA
GCGGGGCGGCTGGCCCGGGCCCTCCTGGCGGACGTCGCCGAGAACGGCGAGGCCCTCGGC
GTCCTGGAGGCGACCATGCGGGAGTCGGGCGCACACGTCTGGGGCAGCTCCGCGGCTGGG
CTGGCGGGCGGCGTGGCGGCTGCCGTGCTGCTGGCGCTGCTGGTCCTGCTGGTGGCGCCG
CCGCTGCTGCGCCGCGCGGGGAGGCTCAGGTGGAGGAGGCACGAGGCGGCGGCCCCGGCT
GGAGCGCCCCTCGGCTTCCGCAACCCGGTGTTCGACGTGACGGCCTCCGAGGAGCTGCCC
CTGCCGCGGCGGCTCAGCCTGGTTCCGAAGGCGGCCGCAGACAGCACCAGCCACAGTTAC
TTCGTCAACCCTCTGTTCGCCGGGGCCGAGGCCGAGGCCTGA
Protein Properties
Number of Residues 453
Molecular Weight 47753.9
Theoretical pI 6.09
Pfam Domain Function Not Available
Signals
  • 1-19
Transmembrane Regions
  • 358-378
Protein Sequence
>Protein amnionless
MGVLGRVLLWLQLCALTQAVSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLV
QEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRS
GDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISALGRTFTRDEDLA
VFLASRAGRLRFHGPGALSVGPEDCADPSGCVCGNAEAQPWICAALLQPLGGRCPQAACH
SALRPQGQCCDLCGAVVLLTHGPAFDLERYRARILDTFLGLPQYHGLQVAVSKVPRSSRL
READTEIQVVLVENGPETGGAGRLARALLADVAENGEALGVLEATMRESGAHVWGSSAAG
LAGGVAAAVLLALLVLLVAPPLLRRAGRLRWRRHEAAAPAGAPLGFRNPVFDVTASEELP
LPRRLSLVPKAAADSTSHSYFVNPLFAGAEAEA
GenBank ID Protein 13507259
UniProtKB/Swiss-Prot ID Q9BXJ7
UniProtKB/Swiss-Prot Entry Name AMNLS_HUMAN
PDB IDs Not Available
GenBank Gene ID AF328788
GeneCard ID AMN
GenAtlas ID AMN
HGNC ID HGNC:14604
References
General References
  1. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  2. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  3. Fyfe JC, Madsen M, Hojrup P, Christensen EI, Tanner SM, de la Chapelle A, He Q, Moestrup SK: The functional cobalamin (vitamin B12)-intrinsic factor receptor is a novel complex of cubilin and amnionless. Blood. 2004 Mar 1;103(5):1573-9. Epub 2003 Oct 23. [PubMed:14576052 ]
  4. Kalantry S, Manning S, Haub O, Tomihara-Newberger C, Lee HG, Fangman J, Disteche CM, Manova K, Lacy E: The amnionless gene, essential for mouse gastrulation, encodes a visceral-endoderm-specific protein with an extracellular cysteine-rich domain. Nat Genet. 2001 Apr;27(4):412-6. [PubMed:11279523 ]
  5. Tanner SM, Aminoff M, Wright FA, Liyanarachchi S, Kuronen M, Saarinen A, Massika O, Mandel H, Broch H, de la Chapelle A: Amnionless, essential for mouse gastrulation, is mutated in recessive hereditary megaloblastic anemia. Nat Genet. 2003 Mar;33(3):426-9. Epub 2003 Feb 18. [PubMed:12590260 ]