Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10744
Secondary Accession Numbers
  • 17007
Name CD97 antigen
Synonyms
  1. CD97 antigen
  2. CD97 antigen subunit alpha
  3. CD97 antigen subunit beta
  4. Leukocyte antigen CD97
Gene Name CD97
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Receptor potentially involved in both adhesion and signaling processes early after leukocyte activation. Plays an essential role in leukocyte migration
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
ion binding
cation binding
metal ion binding
binding
receptor activity
transmembrane receptor activity
molecular transducer activity
signal transducer activity
g-protein coupled receptor activity
calcium ion binding
Process
neuropeptide signaling pathway
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. extracellular space
  2. CD97 antigen subunit alpha:Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13
SNPs CD97
Gene Sequence
>2508 bp
ATGGGAGGCCGCGTCTTTCTCGCATTCTGTGTCTGGCTGACTCTGCCGGGAGCTGAAACC
CAGGACTCCAGGGGCTGTGCCCGGTGGTGCCCTCAGAACTCCTCGTGTGTCAATGCCACC
GCCTGTCGCTGCAATCCAGGGTTCAGCTCTTTTTCTGAGATCATCACCACCCCGACGGAG
ACTTGTGACGACATCAACGAGTGTGCAACACCGTCGAAAGTGTCATGCGGAAAATTCTCG
GACTGCTGGAACACAGAGGGGAGCTACGACTGCGTGTGCAGCCCGGGATATGAGCCTGTT
TCTGGGGCAAAAACATTCAAGAATGAGAGCGAGAACACCTGTCAAGATGTGGACGAATGT
CAGCAGAACCCAAGGCTCTGTAAAAGCTACGGCACCTGCGTCAACACCCTTGGCAGCTAT
ACCTGCCAGTGCCTGCCTGGCTTCAAGTTCATACCTGAGGATCCGAAGGTCTGCACAGAT
GTGAATGAATGCACCTCCGGACAAAACCCGTGCCACAGCTCCACCCACTGCCTCAACAAC
GTGGGCAGCTATCAGTGCCGCTGCCGCCCGGGCTGGCAACCGATTCCGGGGTCCCCCAAT
GGCCCAAACAATACCGTCTGTGAAGATGTGGACGAGTGCAGCTCCGGGCAGCATCAGTGT
GACAGCTCCACCGTCTGCTTCAACACCGTGGGTTCATACAGCTGCCGCTGCCGCCCAGGC
TGGAAGCCCAGACACGGAATCCCGAATAACCAAAAGGACACTGTCTGTGAAGATATGACT
TTCTCCACCTGGACCCCGCCCCCTGGAGTCCACAGCCAGACGCTTTCCCGATTCTTCGAC
AAAGTCCAGGACCTGGGCAGAGACTCCAAGACAAGCTCAGCCGAGGTCACCATCCAGAAT
GTCATCAAATTGGTGGATGAACTGATGGAAGCTCCTGGAGACGTAGAGGCCCTGGCGCCA
CCTGTCCGGCACCTCATAGCCACCCAGCTGCTCTCAAACCTTGAAGATATCATGAGGATC
CTGGCCAAGAGCCTGCCTAAAGGCCCCTTCACCTACATTTCCCCTTCGAACACAGAGCTG
ACCCTGATGATCCAGGAGCGGGGGGACAAGAACGTCACTATGGGTCAGAGCAGCGCACGC
ATGAAGCTGAATTGGGCTGTGGCAGCTGGAGCCGAGGATCCAGGCCCCGCCGTGGCGGGC
ATCCTCTCCATCCAGAACATGACGACATTGCTGGCCAATGCCTCCTTGAACCTGCATTCC
AAGAAGCAAGCCGAACTGGAGGAGATATATGAAAGCAGCATCCGTGGTGTCCAACTCAGA
CGCCTCTCTGCCGTCAACTCCATCTTTCTGAGCCACAACAACACCAAGGAACTCAACTCC
CCCATCCTTTTCGCCTTCTCCCACCTTGAGTCCTCCGATGGGGAGGCGGGAAGAGACCCT
CCTGCCAAGGACGTGATGCCTGGGCCACGGCAGGAGCTGCTCTGTGCCTTCTGGAAGAGT
GACAGCGACAGGGGAGGGCACTGGGCCACCGAGGGCTGCCAGGTGCTGGGCAGCAAGAAC
GGCAGCACCACCTGCCAATGCAGCCACCTGAGCAGCTTTGCGATCCTTATGGCTCATTAT
GACGTGGAGGACTGGAAGCTGACCCTGATCACCAGGGTGGGACTGGCGCTGTCACTCTTC
TGCCTGCTGCTGTGCATCCTCACTTTCCTGCTGGTGCGGCCCATCCAGGGCTCGCGCACC
ACCATACACCTGCACCTCTGCATCTGCCTCTTCGTGGGCTCCACCATCTTCCTGGCCGGC
ATCGAGAACGAAGGCGGCCAGGTGGGGCTGCGCTGCCGCCTGGTGGCCGGGCTGCTGCAC
TACTGTTTCCTGGCCGCCTTCTGCTGGATGAGCCTCGAAGGCCTGGAGCTCTACTTTCTT
GTGGTGCGCGTGTTCCAAGGCCAGGGCCTGAGTACGCGCTGGCTCTGCCTGATCGGCTAT
GGCGTGCCCCTGCTCATCGTGGGCGTCTCGGCTGCCATCTACAGCAAGGGCTACGGCCGC
CCCAGATACTGCTGGTTGGACTTTGAGCAGGGCTTCCTCTGGAGCTTCTTGGGACCTGTG
ACCTTCATCATTTTGTGCAATGCTGTCATTTTCGTGACTACCGTCTGGAAGCTCACTCAG
AAGTTTTCTGAAATCAATCCAGACATGAAGAAATTAAAGAAGGCGAGGGCGCTGACCATC
ACGGCCATCGCGCAGCTCTTCCTGTTGGGCTGCACCTGGGTCTTTGGCCTGTTCATCTTC
GACGATCGGAGCTTGGTGCTGACCTATGTGTTTACCATCCTCAACTGCCTGCAGGGCGCC
TTCCTCTACCTGCTGCACTGCCTGCTCAACAAGAAGGTTCGGGAAGAATACCGGAAGTGG
GCCTGCCTAGTTGCTGGGGGGAGCAAGTACTCAGAATTCACCTCCACCACGTCTGGCACT
GGCCACAATCAGACCCGGGCCCTCAGGGCATCAGAGTCCGGCATATGA
Protein Properties
Number of Residues 835
Molecular Weight 91868.4
Theoretical pI 6.87
Pfam Domain Function
Signals
  • 1-20
Transmembrane Regions
  • 553-572
  • 582-601
  • 621-642
  • 654-674
  • 692-712
  • 740-760
  • 767-789
Protein Sequence
>CD97 antigen
MGGRVFLAFCVWLTLPGAETQDSRGCARWCPQNSSCVNATACRCNPGFSSFSEIITTPTE
TCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDEC
QQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNN
VGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPG
WKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQN
VIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTEL
TLMIQERGDKNVTMGQSSARMKLNWAVAAGAEDPGPAVAGILSIQNMTTLLANASLNLHS
KKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDP
PAKDVMPGPRQELLCAFWKSDSDRGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILMAHY
DVEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAG
IENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGLSTRWLCLIGY
GVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVIFVTTVWKLTQ
KFSEINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYVFTILNCLQGA
FLYLLHCLLNKKVREEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRASESGI
GenBank ID Protein 17978491
UniProtKB/Swiss-Prot ID P48960
UniProtKB/Swiss-Prot Entry Name CD97_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_078481.2
GeneCard ID CD97
GenAtlas ID CD97
HGNC ID HGNC:1711
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973 ]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  5. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  6. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  7. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  8. Hamann J, Eichler W, Hamann D, Kerstens HM, Poddighe PJ, Hoovers JM, Hartmann E, Strauss M, van Lier RA: Expression cloning and chromosomal mapping of the leukocyte activation antigen CD97, a new seven-span transmembrane molecule of the secretion receptor superfamily with an unusual extracellular domain. J Immunol. 1995 Aug 15;155(4):1942-50. [PubMed:7636245 ]
  9. Hamann J, Hartmann E, van Lier RA: Structure of the human CD97 gene: exon shuffling has generated a new type of seven-span transmembrane molecule related to the secretin receptor superfamily. Genomics. 1996 Feb 15;32(1):144-7. [PubMed:8786105 ]
  10. Gray JX, Haino M, Roth MJ, Maguire JE, Jensen PN, Yarme A, Stetler-Stevenson MA, Siebenlist U, Kelly K: CD97 is a processed, seven-transmembrane, heterodimeric receptor associated with inflammation. J Immunol. 1996 Dec 15;157(12):5438-47. [PubMed:8955192 ]
  11. Lin HH, Stacey M, Saxby C, Knott V, Chaudhry Y, Evans D, Gordon S, McKnight AJ, Handford P, Lea S: Molecular analysis of the epidermal growth factor-like short consensus repeat domain-mediated protein-protein interactions: dissection of the CD97-CD55 complex. J Biol Chem. 2001 Jun 29;276(26):24160-9. Epub 2001 Apr 10. [PubMed:11297558 ]
  12. Stacey M, Chang GW, Davies JQ, Kwakkenbos MJ, Sanderson RD, Hamann J, Gordon S, Lin HH: The epidermal growth factor-like domains of the human EMR2 receptor mediate cell attachment through chondroitin sulfate glycosaminoglycans. Blood. 2003 Oct 15;102(8):2916-24. Epub 2003 Jun 26. [PubMed:12829604 ]
  13. Kwakkenbos MJ, Kop EN, Stacey M, Matmati M, Gordon S, Lin HH, Hamann J: The EGF-TM7 family: a postgenomic view. Immunogenetics. 2004 Jan;55(10):655-66. Epub 2003 Nov 27. [PubMed:14647991 ]