You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10752
Secondary Accession Numbers
  • 17019
Name Phosphofurin acidic cluster sorting protein 1
Synonyms
  1. PACS-1
Gene Name PACS1
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Coat protein that is involved in the localization of trans-Golgi network (TGN) membrane proteins that contain acidic cluster sorting motifs. Controls the endosome-to-Golgi trafficking of furin and mannose-6-phosphate receptor by connecting the acidic-cluster-containing cytoplasmic domain of these molecules with the adapter-protein complex-1 (AP-1) of endosomal clathrin- coated membrane pits. Involved in HIV-1 nef-mediated removal of MHC-I from the cell surface to the TGN
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Golgi apparatus
  2. trans-Golgi network
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13.1-q13.2
SNPs PACS1
Gene Sequence
>2892 bp
ATGGCGGAACGCGGAGGGGCGGGCGGTGGTCCCGGAGGCGCCGGGGGCGGCAGCGGCCAG
CGGGGATCCGGGGTCGCCCAGTCCCCTCAGCAGCCGCCGCCGCAGCAGCAGCAGCAGCAG
CCGCCGCAGCAGCCGACGCCCCCCAAGCTGGCCCAGGCCACCTCGTCGTCCTCGTCCACC
TCGGCGGCGGCTGCCTCCTCCTCGTCCTCGTCTACCTCCACCTCCATGGCCGTGGCGGTG
GCCTCGGGCTCCGCGCCTCCCGGTGGCCCGGGGCCAGGCCGCACCCCCGCCCCGGTGCAG
ATGAACCTGTACGCCACCTGGGAGGTGGACCGGAGCTCGTCCAGCTGCGTGCCTAGGCTA
TTCAGCTTGACCCTGAAGAAACTCGTCATGCTAAAAGAAATGGACAAAGATCTTAACTCA
GTGGTCATCGCTGTGAAGCTGCAGGGTTCAAAAAGAATTCTTCGCTCCAACGAGATCGTC
CTTCCAGCTAGTGGACTGGTGGAAACAGAGCTCCAATTAACCTTCTCCCTTCAGTACCCT
CATTTCCTTAAGCGAGATGCCAACAAGCTGCAGATCATGCTGCAAAGGAGAAAACGTTAC
AAGAATCGGACCATCTTGGGCTATAAGACCTTGGCCGTGGGACTCATCAACATGGCAGAG
GTGATGCAGCATCCTAATGAAGGCGCACTGGTGCTTGGCCTACACAGCAACGTGAAGGAT
GTCTCTGTGCCTGTGGCAGAAATAAAGATCTACTCCCTGTCCAGCCAACCCATTGACCAT
GAAGGAATCAAATCCAAGCTTTCTGATCGTTCTCCTGATATTGACAATTATTCTGAGGAA
GAGGAAGAGAGTTTCTCATCAGAACAGGAAGGCAGTGATGATCCATTGCATGGGCAGGAC
TTGTTCTACGAAGACGAAGATCTCCGGAAAGTGAAGAAGACCCGGAGGAAACTAACCTCA
ACCTCTGCCATCACAAGGCAACCTAACATCAAACAGAAGTTTGTGGCCCTCCTGAAGCGG
TTTAAAGTTTCAGATGAGGTGGGCTTTGGGCTGGAGCATGTGTCCCGCGAGCAGATCCGG
GAAGTGGAAGAGGACTTGGATGAATTGTATGACAGTCTGGAGATGTACAACCCCAGCGAC
AGTGGCCCTGAGATGGAGGAGACAGAAAGCATCCTCAGCACGCCAAAGCCCAAGCTCAAG
CCTTTCTTTGAGGGGATGTCGCAGTCCAGCTCCCAGACGGAGATTGGCAGCCTCAACAGC
AAAGGCAGCCTCGGAAAAGACACCACCAGCCCTATGGAATTGGCTGCTCTAGAAAAAATT
AAATCTACTTGGATTAAAAACCAAGATGACAGCTTGACTGAAACAGACACTCTGGAAATC
ACTGACCAGGACATGTTTGGAGATGCCAGCACGAGTCTGGTTGTGCCGGAGAAAGTCAAA
ACTCCCATGAAGTCCAGTAAAACGGATCTCCAGGGCTCTGCCTCCCCCAGCAAAGTGGAG
GGGGTGCACACACCCCGGCAGAAGAGGAGCACGCCCCTGAAGGAGCGGCAGCTCTCCAAG
CCCCTAAGTGAGAGGACCAACAGTTCCGACAGCGAGCGCTCCCCAGATCTGGGCCACAGC
ACGCAGATTCCAAGAAAGGTGGTGTATGACCAGCTCAATCAGATCCTGGTGTCAGATGCA
GCCCTCCCAGAAAATGTCATTCTGGTGAACACCACTGACTGGCAGGGCCAGTATGTGGCT
GAGCTGCTCCAGGACCAGCGGAAGCCTGTGGTGTGCACCTGCTCCACCGTGGAGGTCCAG
GCCGTGCTGTCCGCCCTGCTCACCCGGATCCAGCGCTACTGCAACTGCAACTCTTCCATG
CCGAGGCCAGTGAAGGTGGCTGCTGTGGGAGGCCAGAGCTACCTGAGCTCCATCCTCAGG
TTCTTTGTCAAGTCCCTGGCCAACAAGACCTCCGACTGGCTTGGCTACATGCGCTTCCTC
ATCATCCCCCTCGGTTCTCACCCTGTGGCCAAATACTTGGGGTCAGTCGACAGTAAATAC
AGTAGTTCCTTCCTGGATTCTGGTTGGAGAGATCTGTTCAGTCGCTCGGAGCCACCAGTG
TCAGAGCAACTGGACGTGGCAGGGCGGGTGATGCAGTACGTCAACGGGGCAGCCACGACA
CACCAGCTTCCCGTGGCCGAAGCCATGCTGACTTGCCGGCATAAGTTCCCTGATGAAGAC
TCCTATCAGAAGTTTATTCCCTTCATTGGCGTGGTGAAGGTGGGTCTGGTTGAAGACTCT
CCCTCCACAGCAGGCGATGGGGACGATTCTCCTGTGGTCAGCCTTACTGTGCCCTCCACA
TCACCACCCTCCAGCTCGGGCCTGAGCCGAGACGCCACGGCCACCCCTCCCTCCTCCCCA
TCTATGAGCAGCGCCCTGGCCATCGTGGGGAGCCCTAATAGCCCATATGGGGACGTGATT
GGCCTCCAGGTGGACTACTGGCTGGGCCACCCCGGGGAGCGGAGGAGGGAAGGCGACAAG
AGGGACGCCAGCTCGAAGAACACCCTCAAGAGTGTCTTCCGCTCAGTGCAGGTGTCCCGC
CTGCCCCATAGTGGGGAGGCCCAGCTTTCTGGCACCATGGCCATGACTGTGGTCACCAAA
GAAAAGAACAAGAAAGTTCCCACCATCTTCCTGAGCAAGAAACCCCGAGAAAAGGAGGTG
GATTCTAAGAGCCAGGTCATTGAAGGCATCAGCCGCCTCATCTGCTCAGCCAAGCAGCAG
CAGACTATGCTGAGAGTGTCCATCGATGGGGTCGAGTGGAGTGACATCAAGTTCTTCCAG
CTGGCAGCCCAGTGGCCCACCCATGTCAAGCACTTTCCAGTGGGACTCTTCAGTGGCAGC
AAGGCCACCTGA
Protein Properties
Number of Residues 963
Molecular Weight 104897.6
Theoretical pI 7.86
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Phosphofurin acidic cluster sorting protein 1
MAERGGAGGGPGGAGGGSGQRGSGVAQSPQQPPPQQQQQQPPQQPTPPKLAQATSSSSST
SAAAASSSSSSTSTSMAVAVASGSAPPGGPGPGRTPAPVQMNLYATWEVDRSSSSCVPRL
FSLTLKKLVMLKEMDKDLNSVVIAVKLQGSKRILRSNEIVLPASGLVETELQLTFSLQYP
HFLKRDANKLQIMLQRRKRYKNRTILGYKTLAVGLINMAEVMQHPNEGALVLGLHSNVKD
VSVPVAEIKIYSLSSQPIDHEGIKSKLSDRSPDIDNYSEEEEESFSSEQEGSDDPLHGQD
LFYEDEDLRKVKKTRRKLTSTSAITRQPNIKQKFVALLKRFKVSDEVGFGLEHVSREQIR
EVEEDLDELYDSLEMYNPSDSGPEMEETESILSTPKPKLKPFFEGMSQSSSQTEIGSLNS
KGSLGKDTTSPMELAALEKIKSTWIKNQDDSLTETDTLEITDQDMFGDASTSLVVPEKVK
TPMKSSKTDLQGSASPSKVEGVHTPRQKRSTPLKERQLSKPLSERTNSSDSERSPDLGHS
TQIPRKVVYDQLNQILVSDAALPENVILVNTTDWQGQYVAELLQDQRKPVVCTCSTVEVQ
AVLSALLTRIQRYCNCNSSMPRPVKVAAVGGQSYLSSILRFFVKSLANKTSDWLGYMRFL
IIPLGSHPVAKYLGSVDSKYSSSFLDSGWRDLFSRSEPPVSEQLDVAGRVMQYVNGAATT
HQLPVAEAMLTCRHKFPDEDSYQKFIPFIGVVKVGLVEDSPSTAGDGDDSPVVSLTVPST
SPPSSSGLSRDATATPPSSPSMSSALAIVGSPNSPYGDVIGLQVDYWLGHPGERRREGDK
RDASSKNTLKSVFRSVQVSRLPHSGEAQLSGTMAMTVVTKEKNKKVPTIFLSKKPREKEV
DSKSQVIEGISRLICSAKQQQTMLRVSIDGVEWSDIKFFQLAAQWPTHVKHFPVGLFSGS
KAT
GenBank ID Protein 30089916
UniProtKB/Swiss-Prot ID Q6VY07
UniProtKB/Swiss-Prot Entry Name PACS1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_018026.2
GeneCard ID PACS1
GenAtlas ID PACS1
HGNC ID HGNC:30032
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  7. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  8. Hirosawa M, Nagase T, Ishikawa K, Kikuno R, Nomura N, Ohara O: Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain. DNA Res. 1999 Oct 29;6(5):329-36. [PubMed:10574461 ]
  9. Crump CM, Xiang Y, Thomas L, Gu F, Austin C, Tooze SA, Thomas G: PACS-1 binding to adaptors is required for acidic cluster motif-mediated protein traffic. EMBO J. 2001 May 1;20(9):2191-201. [PubMed:11331585 ]
  10. Piguet V, Wan L, Borel C, Mangasarian A, Demaurex N, Thomas G, Trono D: HIV-1 Nef protein binds to the cellular protein PACS-1 to downregulate class I major histocompatibility complexes. Nat Cell Biol. 2000 Mar;2(3):163-7. [PubMed:10707087 ]
  11. Blagoveshchenskaya AD, Thomas L, Feliciangeli SF, Hung CH, Thomas G: HIV-1 Nef downregulates MHC-I by a PACS-1- and PI3K-regulated ARF6 endocytic pathway. Cell. 2002 Dec 13;111(6):853-66. [PubMed:12526811 ]
  12. Schermer B, Hopker K, Omran H, Ghenoiu C, Fliegauf M, Fekete A, Horvath J, Kottgen M, Hackl M, Zschiedrich S, Huber TB, Kramer-Zucker A, Zentgraf H, Blaukat A, Walz G, Benzing T: Phosphorylation by casein kinase 2 induces PACS-1 binding of nephrocystin and targeting to cilia. EMBO J. 2005 Dec 21;24(24):4415-24. Epub 2005 Nov 24. [PubMed:16308564 ]
  13. Atkins KM, Thomas L, Youker RT, Harriff MJ, Pissani F, You H, Thomas G: HIV-1 Nef binds PACS-2 to assemble a multikinase cascade that triggers major histocompatibility complex class I (MHC-I) down-regulation: analysis using short interfering RNA and knock-out mice. J Biol Chem. 2008 Apr 25;283(17):11772-84. doi: 10.1074/jbc.M707572200. Epub 2008 Feb 22. [PubMed:18296443 ]