You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10819
Secondary Accession Numbers
  • 17099
Name Gamma-aminobutyric acid receptor-associated protein
Synonyms
  1. GABA(A) receptor-associated protein
  2. MM46
Gene Name GABARAP
Protein Type Unknown
Biological Properties
General Function Involved in beta-tubulin binding
Specific Function May play a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
  2. Endomembrane system
  3. Golgi apparatus membrane
  4. cytoskeleton
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13.1
SNPs GABARAP
Gene Sequence
>354 bp
ATGAAGTTCGTGTACAAAGAAGAGCATCCGTTCGAGAAGCGCCGCTCTGAGGGCGAGAAG
ATCCGAAAGAAATACCCGGACCGGGTGCCGGTGATAGTAGAAAAGGCTCCCAAAGCTCGG
ATAGGAGACCTGGACAAAAAGAAATACCTGGTGCCTTCTGATCTCACAGTTGGTCAGTTC
TACTTCTTGATCCGGAAGCGAATTCATCTCCGAGCTGAAGATGCCTTGTTTTTCTTTGTC
AACAATGTCATTCCACCCACCAGTGCCACAATGGGTCAGCTGTACCAGGAACACCATGAA
GAAGACTTCTTTCTCTACATTGCCTACAGTGACGAAAGTGTCTACGGTCTGTGA
Protein Properties
Number of Residues 117
Molecular Weight 13917.9
Theoretical pI 9.21
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Gamma-aminobutyric acid receptor-associated protein
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
GenBank ID Protein 12641851
UniProtKB/Swiss-Prot ID O95166
UniProtKB/Swiss-Prot Entry Name GBRAP_HUMAN
PDB IDs
GenBank Gene ID AB030711
GeneCard ID GABARAP
GenAtlas ID GABARAP
HGNC ID HGNC:4067
References
General References
  1. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed:10931946 ]
  2. Okazaki N, Yan J, Yuasa S, Ueno T, Kominami E, Masuho Y, Koga H, Muramatsu M: Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain: possible role of vesicular transport in axonal elongation. Brain Res Mol Brain Res. 2000 Dec 28;85(1-2):1-12. [PubMed:11146101 ]
  3. Wang H, Bedford FK, Brandon NJ, Moss SJ, Olsen RW: GABA(A)-receptor-associated protein links GABA(A) receptors and the cytoskeleton. Nature. 1999 Jan 7;397(6714):69-72. [PubMed:9892355 ]
  4. Knight D, Harris R, McAlister MS, Phelan JP, Geddes S, Moss SJ, Driscoll PC, Keep NH: The X-ray crystal structure and putative ligand-derived peptide binding properties of gamma-aminobutyric acid receptor type A receptor-associated protein. J Biol Chem. 2002 Feb 15;277(7):5556-61. Epub 2001 Nov 29. [PubMed:11729197 ]
  5. Stangler T, Mayr LM, Willbold D: Solution structure of human GABA(A) receptor-associated protein GABARAP: implications for biolgoical funcrion and its regulation. J Biol Chem. 2002 Apr 19;277(16):13363-6. Epub 2002 Mar 1. [PubMed:11875056 ]
  6. Kouno T, Miura K, Kanematsu T, Shirakawa M, Hirata M, Kawano K: 1H, 13C and '5N resonance assignments of GABARAP, GABAA receptor associated protein. J Biomol NMR. 2002 Jan;22(1):97-8. [PubMed:11885988 ]