You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10826
Secondary Accession Numbers
  • 17108
Name D(1B) dopamine receptor
Synonyms
  1. D(5) dopamine receptor
  2. D1beta dopamine receptor
  3. Dopamine D5 receptor
Gene Name DRD5
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function This is one of the five types (D1 to D5) of receptors for dopamine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
transmembrane receptor activity
dopamine receptor activity
molecular transducer activity
signal transducer activity
g-protein coupled receptor activity
g-protein coupled amine receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:4
Locus 4p16.1
SNPs DRD5
Gene Sequence
>1434 bp
ATGCTGCCGCCAGGCAGCAACGGCACCGCGTACCCGGGGCAGTTCGCTCTATACCAGCAG
CTGGCGCAGGGGAACGCCGTGGGGGGCTCGGCGGGGGCACCGCCACTGGGGCCCTCACAG
GTGGTCACCGCCTGCCTGCTGACCCTACTCATCATCTGGACCCTGCTGGGCAACGTGCTG
GTGTGCGCAGCCATCGTGCGGAGCCGCCACCTGCGCGCCAACATGACCAACGTCTTCATC
GTGTCTCTGGCCGTGTCAGACCTTTTCGTGGCGCTGCTGGTCATGCCCTGGAAGGCAGTC
GCCGAGGTGGCCGGTTACTGGCCCTTTGGAGCGTTCTGCGACGTCTGGGTGGCCTTCGAC
ATCATGTGCTCCACTGCCTCCATCCTGAACCTGTGCGTCATCAGCGTGGACCGCTACTGG
GCCATCTCCAGGCCCTTCCGCTACAAGCGCAAGATGACTCAGCGCATGGCCTTGGTCATG
GTCGGCCTGGCATGGACCTTGTCCATCCTCATCTCCTTCATTCCGGTCCAGCTCAACTGG
CACAGGGACCAGGCGGCCTCTTGGGGCGGGCTGGACCTGCCAAACAACCTGGCCAACTGG
ACGCCCTGGGAGGAGGACTTTTGGGAGCCCGACGTGAATGCAGAGAACTGTGACTCCAGC
CTGAATCGAACCTACGCCATCTCTTCCTCGCTCATCAGCTTCTACATCCCCGTTGCCATC
ATGATCGTGACCTACACGCGCATCTACCGCATCGCCCAGGTGCAGATCCGCAGGATTTCC
TCCCTGGAGAGGGCCGCAGAGCACGCGCAGAGCTGCCGGAGCAGCGCAGCCTGCGCGCCC
GACWCCAGCCTGCGCGCTTCCATCAAGAAGGAGACCAAGGTTCTCAAGACCCTGTCGGTG
ATCATGGGGGTCTTCGTGTGTTGCTGGCTGCCCTTCTTCATCCTTAACTGCATGGTCCCT
TTCTGCAGTGGACACCCTGAAGGCCCTCCGGCCGGCTTCCCCTGCGTCAGTGAGACCACC
TTCGACGTCTTCGTCTGGTTCGGCTGGGCTAACTCCTCACTCAACCCCGTCATCTATGCC
TTCAACGCCGACTTTCAGAAGGTGTTTGCCCAGCTGCTGGGGTGCAGCCACTTCTGCTCC
CGCACGCCGGTGGAGACGGTGAACATCAGCAATGAGCTCATCTCCTACAACCAAGACATC
GTCTTCCACAAGGAAATCGCAGCTGCCTACATCCACATGATGCCCAACGCCGTTACCCCC
GGCAACCGGGAGGTGGACAACGACGAGGAGGAGGGTCCTTTCGATCGCATGTTCCAGATC
TATCAGACGTCCCCAGATGGTGACCCTGTTGCTGAGTCTGTCTGGGAGCTGGACTGCGAG
GGGGAGATTTCTTTAGACAAAATAACACCTTTCACCCCGAATGGATTCCATTAA
Protein Properties
Number of Residues 477
Molecular Weight 52950.5
Theoretical pI 5.08
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 40-66
  • 78-104
  • 115-136
  • 159-180
  • 224-246
  • 297-320
  • 341-360
Protein Sequence
>D(1B) dopamine receptor
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
GenBank ID Protein 22658483
UniProtKB/Swiss-Prot ID P21918
UniProtKB/Swiss-Prot Entry Name DRD5_HUMAN
PDB IDs Not Available
GenBank Gene ID AY136750
GeneCard ID DRD5
GenAtlas ID DRD5
HGNC ID HGNC:3026
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [PubMed:10391209 ]
  4. Sunahara RK, Guan HC, O'Dowd BF, Seeman P, Laurier LG, Ng G, George SR, Torchia J, Van Tol HH, Niznik HB: Cloning of the gene for a human dopamine D5 receptor with higher affinity for dopamine than D1. Nature. 1991 Apr 18;350(6319):614-9. [PubMed:1826762 ]
  5. Grandy DK, Zhang YA, Bouvier C, Zhou QY, Johnson RA, Allen L, Buck K, Bunzow JR, Salon J, Civelli O: Multiple human D5 dopamine receptor genes: a functional receptor and two pseudogenes. Proc Natl Acad Sci U S A. 1991 Oct 15;88(20):9175-9. [PubMed:1833775 ]
  6. Weinshank RL, Adham N, Macchi M, Olsen MA, Branchek TA, Hartig PR: Molecular cloning and characterization of a high affinity dopamine receptor (D1 beta) and its pseudogene. J Biol Chem. 1991 Nov 25;266(33):22427-35. [PubMed:1834671 ]
  7. Karpa KD, Lidow MS, Pickering MT, Levenson R, Bergson C: N-linked glycosylation is required for plasma membrane localization of D5, but not D1, dopamine receptors in transfected mammalian cells. Mol Pharmacol. 1999 Nov;56(5):1071-8. [PubMed:10531415 ]
  8. Misbahuddin A, Placzek MR, Chaudhuri KR, Wood NW, Bhatia KP, Warner TT: A polymorphism in the dopamine receptor DRD5 is associated with blepharospasm. Neurology. 2002 Jan 8;58(1):124-6. [PubMed:11781417 ]
  9. Sobell JL, Lind TJ, Sigurdson DC, Zald DH, Snitz BE, Grove WM, Heston LL, Sommer SS: The D5 dopamine receptor gene in schizophrenia: identification of a nonsense change and multiple missense changes but lack of association with disease. Hum Mol Genet. 1995 Apr;4(4):507-14. [PubMed:7633397 ]