You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10834
Secondary Accession Numbers
  • 17121
Name Ammonium transporter Rh type C
Synonyms
  1. Rh family type C glycoprotein
  2. Rh glycoprotein kidney
  3. Rh type C glycoprotein
  4. Rhesus blood group family type C glycoprotein
  5. Tumor-related protein DRC2
Gene Name RHCG
Protein Type Unknown
Biological Properties
General Function Involved in ammonium transmembrane transporter activity
Specific Function Functions as an electroneutral and bidirectional ammonium transporter. May regulate transepithelial ammonia secretion.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
cellular ion homeostasis
transepithelial ammonium transport
amine transport
epithelial cell differentiation
regulation of pH
Cellular Component
basolateral plasma membrane
apical plasma membrane
cytoplasmic vesicle
integral to plasma membrane
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
transporter activity
organic cation transmembrane transporter activity
ammonium transmembrane transporter activity
Molecular Function
ammonia transmembrane transporter activity
ammonium transmembrane transporter activity
ankyrin binding
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Multi-pass membrane protein
  2. Apical cell membrane
Gene Properties
Chromosome Location 15
Locus 15q25
SNPs RHCG
Gene Sequence
>1440 bp
ATGGCCTGGAACACCAACCTCCGCTGGCGGCTGCCGCTCACCTGCCTGCTCCTGCAGGTG
ATTATGGTGATTCTCTTCGGGGTGTTCGTGCGCTACGACTTCGAGGCCGACGCCCACTGG
TGGTCAGAGAGGACGCACAAGAACTTGAGCGACATGGAGAACGAATTCTACTATCGCTAC
CCAAGCTTCCAGGACGTGCACGTGATGGTCTTCGTGGGCTTCGGCTTCCTCATGACTTTC
CTGCAGCGCTACGGCTTCAGCGCCGTGGGCTTCAACTTCCTGTTGGCAGCCTTCGGCATC
CAGTGGGCGCTGCTCATGCAGGGCTGGTTCCACTTCTTACAAGACCGCTACATCGTCGTG
GGCGTGGAGAACCTCATCAACGCTGACTTCTGCGTGGCCTCTGTCTGCGTGGCCTTTGGG
GCAGTTCTGGGTAAAGTCAGCCCCATTCAGCTGCTCATCATGACTTTCTTCCAAGTGACC
CTCTTCGCTGTGAATGAGTTCATTCTCCTTAACCTGCTAAAGGTGAAGGATGCAGGAGGC
TCCATGACCATCCACACATTTGGCGCCTACTTTGGGCTCACAGTGACCCGGATCCTCTAC
CGACGCAACCTAGAGCAGAGCAAGGAGAGACAGAATTCTGTGTACCAGTCGGACCTCTTT
GCCATGATTGGCACCCTCTTCCTGTGGATGTACTGGCCCAGCTTCAACTCAGCCATATCC
TACCATGGGGACAGCCAGCACCGAGCCGCCATCAACACCTACTGCTCCTTGGCAGCCTGC
GTGCTTACCTCGGTGGCAATATCCAGTGCCCTGCACAAGAAGGGCAAGCTGGACATGGTG
CACATCCAGAATGCCACGCTCGCAGGAGGGGTGGCCGTGGGTACCGCTGCTGAGATGATG
CTCATGCCTTACGGTGCCCTCATCATCGGCTTCGTCTGCGGCATCATCTCCACCCTGGGT
TTTGTATACCTGACCCCATTCCTGGAGTCCCGGCTGCACATCCAGGACACATGTGGCATT
AACAATCTGCATGGCATTCCTGGCATCATAGGCGGCATCGTGGGTGCTGTGACAGCGGCC
TCCGCCAGCCTTGAAGTCTATGGAAAAGAAGGGCTTGTCCATTCCTTTGACTTTCAAGGT
TTCAACGGGGACTGGACCGCAAGAACACAGGGAAAGTTCCAGATTTATGGTCTCTTGGTG
ACCCTGGCCATGGCCCTGATGGGTGGCATCATTGTGGGGCTCATTTTGAGATTACCATTC
TGGGGACAACCTTCAGATGAGAACTGCTTTGAGGATGCGGTCTACTGGGAGATGCCTGAA
GGGAACAGCACTGTCTACATCCCTGAGGACCCCACCTTCAAGCCCTCAGGACCCTCAGTA
CCCTCAGTACCCATGGTGTCCCCACTACCCATGGCTTCCTCGGTACCCTTGGTACCCTAG
Protein Properties
Number of Residues 479
Molecular Weight 53178.56
Theoretical pI 6.39
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Ammonium transporter Rh type C
MAWNTNLRWRLPLTCLLLQVIMVILFGVFVRYDFEADAHWWSERTHKNLSDMENEFYYRY
PSFQDVHVMVFVGFGFLMTFLQRYGFSAVGFNFLLAAFGIQWALLMQGWFHFLQDRYIVV
GVENLINADFCVASVCVAFGAVLGKVSPIQLLIMTFFQVTLFAVNEFILLNLLKVKDAGG
SMTIHTFGAYFGLTVTRILYRRNLEQSKERQNSVYQSDLFAMIGTLFLWMYWPSFNSAIS
YHGDSQHRAAINTYCSLAACVLTSVAISSALHKKGKLDMVHIQNATLAGGVAVGTAAEMM
LMPYGALIIGFVCGIISTLGFVYLTPFLESRLHIQDTCGINNLHGIPGIIGGIVGAVTAA
SASLEVYGKEGLVHSFDFQGFNGDWTARTQGKFQIYGLLVTLAMALMGGIIVGLILRLPF
WGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPLVP
GenBank ID Protein 6625732
UniProtKB/Swiss-Prot ID Q9UBD6
UniProtKB/Swiss-Prot Entry Name RHCG_HUMAN
PDB IDs
GenBank Gene ID AF193809
GeneCard ID RHCG
GenAtlas ID RHCG
HGNC ID HGNC:18140
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Marini AM, Matassi G, Raynal V, Andre B, Cartron JP, Cherif-Zahar B: The human Rhesus-associated RhAG protein and a kidney homologue promote ammonium transport in yeast. Nat Genet. 2000 Nov;26(3):341-4. [PubMed:11062476 ]
  3. Liu Z, Chen Y, Mo R, Hui C, Cheng JF, Mohandas N, Huang CH: Characterization of human RhCG and mouse Rhcg as novel nonerythroid Rh glycoprotein homologues predominantly expressed in kidney and testis. J Biol Chem. 2000 Aug 18;275(33):25641-51. [PubMed:10852913 ]
  4. Chen BS, Xu ZX, Xu X, Cai Y, Han YL, Wang J, Xia SH, Hu H, Wei F, Wu M, Wang MR: RhCG is downregulated in oesophageal squamous cell carcinomas, but expressed in multiple squamous epithelia. Eur J Cancer. 2002 Sep;38(14):1927-36. [PubMed:12204676 ]
  5. Bakouh N, Benjelloun F, Hulin P, Brouillard F, Edelman A, Cherif-Zahar B, Planelles G: NH3 is involved in the NH4+ transport induced by the functional expression of the human Rh C glycoprotein. J Biol Chem. 2004 Apr 16;279(16):15975-83. Epub 2004 Feb 3. [PubMed:14761968 ]
  6. Zidi-Yahiaoui N, Mouro-Chanteloup I, D'Ambrosio AM, Lopez C, Gane P, Le van Kim C, Cartron JP, Colin Y, Ripoche P: Human Rhesus B and Rhesus C glycoproteins: properties of facilitated ammonium transport in recombinant kidney cells. Biochem J. 2005 Oct 1;391(Pt 1):33-40. [PubMed:15929723 ]
  7. Marini AM, Boeckstaens M, Benjelloun F, Cherif-Zahar B, Andre B: Structural involvement in substrate recognition of an essential aspartate residue conserved in Mep/Amt and Rh-type ammonium transporters. Curr Genet. 2006 Jun;49(6):364-74. Epub 2006 Feb 14. [PubMed:16477434 ]
  8. Zidi-Yahiaoui N, Ripoche P, Le Van Kim C, Gane P, D'Ambrosio AM, Cartron JP, Colin Y, Mouro-Chanteloup I: Ammonium transport properties of HEK293 cells expressing RhCG mutants: preliminary analysis of structure/function by site-directed mutagenesis. Transfus Clin Biol. 2006 Mar-Apr;13(1-2):128-31. Epub 2006 Apr 3. [PubMed:16580862 ]