You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10881
Secondary Accession Numbers
  • 17179
Name Proton-coupled amino acid transporter 2
Synonyms
  1. Proton/amino acid transporter 2
  2. Solute carrier family 36 member 2
  3. Tramdorin-1
Gene Name SLC36A2
Protein Type Unknown
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Involved in a pH-dependent electrogenic neuronal transport and sequestration of small amino acids amino acids such as glycine, alanine and proline. Inhibited by sarcosine
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Cytoplasm
  3. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:5
Locus 5q33.1
SNPs SLC36A2
Gene Sequence
>1452 bp
ATGTCTGTGACAAAAAGTACTGAGGGTCCCCAGGGAGCCGTTGCCATCAAATTGGACCTT
ATGTCGCCTCCTGAAAGTGCCAAGAAGTTGGAGAACAAGGACTCTACATTCTTGGATGAA
AGTCCTTCAGAGTCAGCAGGCTTGAAGAAGACCAAGGGCATAACAGTGTTCCAGGCCTTG
ATTCACCTGGTGAAAGGCAACATGGGCACAGGGATCCTGGGACTACCCCTCGCTGTGAAG
AACGCGGGCATCCTGATGGGCCCACTCAGTCTGCTGGTGATGGGCTTCATTGCCTGCCAC
TGTATGCACATCCTGGTCAAGTGTGCCCAGCGCTTCTGTAAGAGGCTTAACAAGCCCTTT
ATGGACTATGGGGACACGGTGATGCATGGACTAGAAGCCAACCCCAACGCCTGGCTCCAG
AATCACGCTCACTGGGGAAGGCATATCGTGAGCTTCTTCCTTATTATCACCCAACTTGGC
TTCTGCTGTGTGTACATTGTGTTTTTGGCTGATAATTTAAAACAGGTAGTGGAAGCTGTT
AATAGCACAACCAACAACTGCTATTCCAATGAGACGGTGATTCTGACCCCCACCATGGAC
TCGCGACTCTACATGCTCTCCTTCCTGCCCTTCCTGGTGCTGCTGGTCCTCATCCGGAAC
CTCAGGATCTTGACCATCTTCTCCATGCTGGCCAACATCAGCATGCTGGTCAGCTTGGTC
ATCATCATACAGTACATTACCCAGGAAATCCCAGACCCCAGCCGGTTGCCACTGGTAGCA
AGCTGGAAGACCTACCCTCTCTTCTTCGGAACAGCCATTTTTTCTTTTGAAAGCATTGGT
GTGGTTCTGCCTCTGGAAAACAAGATGAAGAATGCCCGCCACTTCCCAGCCATCCTGTCT
TTGGGAATGTCCATCGTCACTTCCCTATACATTGGCATGGCGGCTCTGGGCTACCTGCGG
TTTGGAGATGACATCAAGGCCAGCATAAGCCTTAACCTGCCTAACTGCTGGCTGTACCAG
TCTGTCAAGCTTCTCTACATTGCCGGCATCCTGTGCACCTATGCCCTGCAGTTCTACGTC
CCTGCAGAAATCATCATCCCCTTTGCCATCTCCCGGGTGTCAACACGCTGGGCACTGCCT
CTGGATCTGTCCATTCGCCTCGTCATGGTCTGCCTGACATGCCTCCTGGCCATCCTCATC
CCCCGCCTGGACCTGGTCATCTCCCTGATGGGCTCCGTGAGTGGCACCGCCCTGGCCCTC
ATCATCCCACCGCTCCTGGAGGTCCCCACGTTCTACTCAGAGGGCATGAGCCCCCTCACC
ATCTTCAAGGACGCCCTGATCAGCATCCTGGGCTTCGTGGGCTTTGTGGTGGGGACCTAC
CAGGCCCTGGACGAGCTGCTCAAGTCAGAAGACTCTCACCCCTTTTCCAACTCCACCACT
TTTGTTCGGTGA
Protein Properties
Number of Residues 483
Molecular Weight 53215.7
Theoretical pI 8.2
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 59-79
  • 82-102
  • 149-169
  • 198-218
  • 223-243
  • 265-285
  • 297-317
  • 350-370
  • 380-400
  • 405-425
  • 438-458
Protein Sequence
>Proton-coupled amino acid transporter 2
MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQAL
IHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGFIACHCMHILVKCAQRFCKRLNKPF
MDYGDTVMHGLEANPNAWLQNHAHWGRHIVSFFLIITQLGFCCVYIVFLADNLKQVVEAV
NSTTNNCYSNETVILTPTMDSRLYMLSFLPFLVLLVLIRNLRILTIFSMLANISMLVSLV
IIIQYITQEIPDPSRLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKNARHFPAILS
LGMSIVTSLYIGMAALGYLRFGDDIKASISLNLPNCWLYQSVKLLYIAGILCTYALQFYV
PAEIIIPFAISRVSTRWALPLDLSIRLVMVCLTCLLAILIPRLDLVISLVGSVSGTALAL
IIPPLLEVTTFYSEGMSPLTIFKDALISILGFVGFVVGTYQALDELLKSEDSHPFSNSTT
FVR
GenBank ID Protein 34527813
UniProtKB/Swiss-Prot ID Q495M3
UniProtKB/Swiss-Prot Entry Name S36A2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK122630
GeneCard ID SLC36A2
GenAtlas ID SLC36A2
HGNC ID HGNC:18762
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Boll M, Foltz M, Rubio-Aliaga I, Daniel H: A cluster of proton/amino acid transporter genes in the human and mouse genomes. Genomics. 2003 Jul;82(1):47-56. [PubMed:12809675 ]
  4. Bermingham JR Jr, Pennington J: Organization and expression of the SLC36 cluster of amino acid transporter genes. Mamm Genome. 2004 Feb;15(2):114-25. [PubMed:15058382 ]