You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10902
Secondary Accession Numbers
  • 17202
Name Stabilin-1
Synonyms
  1. FEEL-1
  2. Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 1
  3. MS-1 antigen
Gene Name STAB1
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Acts as a scavenger receptor for acetylated low density lipoprotein. Binds to both Gram-positive and Gram-negative bacteria and may play a role in defense against bacterial infection. When inhibited in endothelial tube formation assays, there is a marked decrease in cell-cell interactions, suggesting a role in angiogenesis. Involved in the delivery of newly synthesized CHID1/SI-CLP from the biosynthetic compartment to the endosomal/lysosomal system
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
pattern binding
polysaccharide binding
glycosaminoglycan binding
hyaluronic acid binding
Process
cell adhesion
cellular process
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:3
Locus 3p21.1
SNPs STAB1
Gene Sequence
>7713 bp
ATGGCGGGGCCCCGGGGCCTCCTCCCACTCTGCCTCCTGGCCTTCTGCCTGGCAGGCTTC
AGCTTCGTCAGGGGGCAGGTGCTGTTCAAAGGCTGTGATGTGAAAACCACGTTTGTCACT
CATGTACCCTGCACCTCGTGCGCGGCCATCAAGAAGCAGACGTGTCCCTCAGGCTGGCTG
CGGGAGCTCCCGGATCAGATAACCCAGGACTGCCGCTACGAAGTACAGCTGGGGGGCTCT
ATGGTGTCCATGAGCGGCTGCAGACGGAAGTGCCGGAAGCAAGTGGTGCAGAAGGCCTGC
TGCCCTGGCTACTGGGGTTCCCGGTGCCATGAATGCCCTGGGGGCGCTGAGACCCCATGC
AATGGCCACGGGACCTGCTTGGATGGCATGGACAGGAATGGGACCTGTGTGTGCCAGGAA
AACTTCCGCGGCTCAGCCTGCCAGGAGTGCCAAGACCCCAACCGGTTCGGGCCTGACTGC
CAATCGGTGTGCAGCTGTGTGCACGGAGTGTGCAACCATGGGCCACGTGGGGATGGAAGC
TGCCTGTGCTTTGCTGGATACACTGGCCCCCACTGTGATCAAGAGCTGCCCGTCTGCCAG
GAGCTGCGCTGTCCCCAGAACACCCAGTGCTCCGCAGAGGCTCCCAGCTGCAGGTGCCTG
CCCGGCTACACACAGCAGGGCAGTGAATGCCGAGCCCCCAACCCCTGCTGGCCATCACCC
TGCTCACTGCTGGCCCAGTGCTCGGTGAGCCCCAAGGGGCAGGCTCAGTGTCACTGCCCT
GAGAACTACCATGGCGATGGGATGGTGTGTCTGCCCAAGGACCCATGCACTGACAACCTT
GGTGGCTGCCCCAGCAACTCTACTTTGTGTGTGTACCAGAAGCCGGGCCAGGCCTTCTGC
ACCTGCCGGCCAGGCCTGGTCAGCATCAACAGCAACGCTTCTGCGGGCTGCTTCGCCTTC
TGCTCCCCCTTCTCCTGCGACCGGTCTGCCACTTGCCAGGTGACCGCTGATGGGAAGACC
AGCTGTGTGTGCAGGGAAAGCGAGGTGGGGGATGGGCGTGCCTGCTACGGACACCTGCTC
CACGAGGTGCAGAAGGCCACGCAGACAGGCCGGGTGTTCCTGCAGCTGAGGGTCGCCGTG
GCCATGATGGACCAGGGCTGCCGGGAAATCCTTACCACAGCGGGCCCTTTCACCGTGCTG
GTGCCATCCGTCTCCTCCTTCTCCTCCAGGACCATGAATGCATCCCTTGCCCAGCAGCTC
TGTAGACAGCACATCATCGCAGGGCAGCACATCCTGGAGGACACAAGGACCCAACAAACA
CGAAGGTGGTGGACGCTGGCCGGGCAGGAGATCACCGTCACCTTTAACCAATTCACGAAA
TACTCCTACAAGTACAAAGACCAGCCCCAGCAGACGTTCAACATCTACAAGGCCAACAAC
ATAGCAGCTAATGGCGTCTTCCACGTGGTCACTGGCCTGCGGTGGCAGGCCCCCTCTGGG
ACCCCTGGGGATCCCAAGAGAACTATCGGACAGATCCTCGCCTCTACCGAGGCCTTCAGC
CGCTTTGAAACCATCCTGGAGAACTGTGGGCTGCCCTCCATCCTGGACGGACCTGGGCCC
TTCACAGTCTTTGCCCCAAGCAATGAGGCTGTGGACAGCTTGCGTGACGGCCGCCTGATC
TACCTCTTCACAGCGGGTCTCTCTAAACTGCAGGAGTTGGTGCGGTACCACATCTACAAC
CACGGCCAGCTGACCGTTGAGAAGCTCATCTCCAAGGGTCGGATCCTCACCATGGCGAAC
CAGGTCCTGGCTGTGAACATTTCTGAGGAGGGGCGCATCCTGCTGGGACCCGAGGGGGTC
CCGCTGCAGAGGGTAGACGTGATGGCCGCCAATGGCGTGATCCACATGCTGGACGGCATC
CTGCTGCCCCCGACCATCCTGCCCATCCTGCCCAAGCACTGCAGCGAGGAGCAGCACAAG
ATTGTGGCGGGCTCCTGTGTGGACTGCCAAGCCCTGAACACCAGCACGTGTCCCCCCAAC
AGTGTGAAGCTGGACATCTTCCCCAAGGAGTGTGTCTACATCCATGACCCAACGGGGCTC
AATGTGCTAAAGAAGGGCTGTGCCAGCTACTGCAACCAAACCATCATGGAACAAGGCTGC
TGCAAAGGTTTTTTCGGGCCTGACTGCACGCAGTGTCCTGGGGGCTTCTCCAACCCCTGC
TATGGCAAAGGCAATTGCAGTGATGGGATCCAGGGCAATGGGGCCTGCCTCTGCTTCCCA
GACTACAAGGGCATCGCCTGCCACATCTGCTCGAACCCAAACAAGCATGGAGAGCAATGC
CAGGAAGACTGCGGCTGTGTCCATGGTCTCTGCGACAACCGCCCAGGCAGTGGGGGGGTG
TGCCAGCAGGGCACGTGTGCCCCTGGCTTCAGTGGCCGGTTCTGCAACGAGTCCATGGGG
GACTGTGGGCCCACAGGGCTGGCCCAGCACTGCCACCTGCATGCCCGCTGTGTTAGCCAG
GAGGGTGTTGCCAGATGTCGCTGTCTTGATGGCTTTGAGGGTGATGGCTTCTCCTGCACA
CCTAGCAACCCCTGCTCCCACCCGGACCGTGGAGGCTGCTCAGAGAATGCTGAGTGTGTC
CCTGGGTCCCTGGGCACCCACCACTGCACATGCCACAAAGGCTGGAGTGGGGATGGCCGC
GTCTGTGTGGCTATTGACGAGTGTGAGCTGGACGTGAGAGGTGGCTGCCACACCGATGCC
CTCTGCAGCTATGTGGGCCCCGGGCAGAGCCGATGCACCTGCAAGCTGGGCTTTGCCGGG
GATGGCTACCAGTGCAGCCCCATCGACCCCTGCCGGGCAGGCAATGGCGGCTGCCACGGC
CTGGCCACCTGCCGGGCAGTGGGGGGAGGTCAGCGGGTCTGCACGTGCCCCCCTGGCTTT
GGGGGTGATGGCTTCAGCTGTTATGGAGACATCTTCCGGGAGCTGGAGGCAAATGCCCAC
TTCTCCATCTTCTACCAATGGCTTAAGAGTGCCGGCATCACGCTTCCTGCCGACCGCCGA
GTCACAGCCCTGGTGCCCTCCGAGGCTGCAGTCCGTCAGCTGAGCCCCGAGGACCGAGCT
TTCTGGCTGCAGCCAAGGACGCTGCCGAACCTGGTCAGGGCCCATTTTCTCCAGGGTGCC
CTCTTCGAGGAGGAGCTGGCCCGGCTGGGTGGGCAGGAAGTGGCCACCCTGAACCCCACC
ACACGCTGGGAGATTCGCAACATTAGTGGGAGGGTCTGGGTGCAGAATGCCAGCGTGGAT
GTGGCTGACCTCCTTGCCACCAACGGTGTCCTACACATCCTCAGCCAGGTCTTACTGCCC
CCCCGAGGGGATGTGCCCGGTGGGCAGGGGTTGCTGCAGCAGCTGGACTTGGTGCCTGCC
TTCAGCCTCTTCCGGGAATTGCTGCAGCACCATGGGTTGGTGCCCCAGATTGAGGCTGCC
ACTGCCTACACCATCTTTGTGCCCACCAACCGCTCCCTGGAGGCCCAGGGCAACAGCAGT
CACCTGGACGCAGACACAGTGCGGCACCATGTGGTCCTGGGGGAGGCCCTCTCCATGGAA
ACCCTGCGGAAGGGTGGACACCGCAACTCCCTCCTGGGCCCTGCCCACTGGATCGTCTTC
TACAACCACAGTGGCCAGCCTGAGGTGAACCATGTGCCACTGGAAGGCCCCATGCTGGAG
GCCCCTGGCCGCTCGCTGATTGGTCTGTCGGGGGTCCTGACGGTGGGCTCAAGTCGCTGT
CTGCATAGCCACGCTGAGGCCCTGCGGGAGAAATGTGTAAACTGCACCAGGAGATTCCGC
TGCACTCAGGGCTTCCAGCTGCAGGACACACCCAGGAAGAGCTGTGTCTACCGATCTGGC
TTCTCCTTCTCCCGGGGCTGCTCTTACACATGTGCCAAGAAGATCCAGGTGCCGGACTGC
TGCCCTGGTTTCTTTGGCACGCTGTGTGAGCCATGCCCAGGGGGTCTAGGGGGGGTGTGC
TCAGGCCATGGGCAGTGCCAGGACAGGTTCCTGGGCAGCGGGGAGTGCCACTGCCACGAG
GGCTTCCATGGAACGGCCTGTGAGGTGTGTGAGCTGGGCCGCTACGGGCCCAACTGCACC
GGAGTGTGTGACTGTGCCCATGGGCTGTGCCAGGAGGGGCTGCAAGGGGACGGAAGCTGT
GTCTGTAACGTGGGCTGGCAGGGCCTCCGCTGTGACCAGAAAATCACCAGCCCTCAGTGC
CCTAGGAAGTGCGACCCCAATGCCAACTGCGTGCAGGACTCGGCCGGAGCCTCCACCTGC
GCCTGTGCTGCGGGATACTCCGGCAATGGCATCTTCTGTTCAGAGGTGGACCCCTGCGCC
CACGGCCATGGGGGCTGCTCCCCTCATGCCAACTGTACCAAGGTGGCACCTGGGCAGCGG
ACATGCACCTGCCAGGATGGCTACATGGGCGACGGGGAGCTGTGCCAGGAAATTAACAGC
TGTCTCATCCACCACGGGGGCTGCCACATTCACGCCGAGTGCATCCCCACTGGCCCCCAG
CAGGTCTCCTGCAGCTGCCGTGAGGGTTACAGCGGGGATGGCATCCGGACCTGCGAGCTC
CTGGACCCCTGCTCTAAGAACAATGGAGGATGCAGCCCATATGCCACCTGCAAAAGCACA
GGGGATGGCCAGAGGACATGTACCTGCGACACAGCCCACACCGTGGGGGACGGCCTCACC
TGCCGTGCCCGAGTCGGCCTGGAGCTCCTGAGGGATAAGCATGCCTCATTCTTCAGCCTC
CGCCTCCTGGAATATAAGGAGCTCAAGGGCGATGGGCCTTTCACCATCTTCGTGCCGCAC
GCAGATCTAATGAGCAACCTGTCGCAGGATGAGCTGGCCCGGATTCGTGCGCATCGCCAG
CTGGTGTTTCGCTACCACGTGGTTGGCTGTCGGCGGCTGCGGAGCGAGGACCTGCTGGAG
CAGGGGTACGCCACGGCCCTCTCAGGGCACCCACTGCGCTTCAGCGAGAGGGAGGGCAGC
ATATACCTCAATGACTTCGCGCGCGTGGTGAGCAGCGACCATGAGGCCGTGAACGGCATC
CTGCACTTCATTGACCGTGTCCTGCTGCCCCCCGAGGCGCTGCACTGGGAGCCTGATGAT
GCTCCCATCCCGAGGAGAAATGTCACCGCCGCCGCCCAGGGCTTCGGTTACAAGATCTTC
AGCGGCCTCCTGAAGGTGGCCGGCCTCCTGCCCCTGCTTCGAGAGGCATCCCATAGGCCC
TTCACAATGCTGTGGCCCACAGACGCCGCCTTTCGAGCTCTGCCTCCGGATCGCCAGGCC
TGGCTGTACCATGAGGACCACCGTGACAAGCTAGCAGCCATTCTGCGGGGCCACATGATT
CGCAATGTCGAGGCCTTGGCATCTGACCTGCCCAACCTGGGCCCACTTCGAACCATGCAT
GGGACCCCCATCTCTTTCTCCTGCAGCCGAACGCGGGCCGGTGAGCTCATGGTGGGTGAG
GATGATGCTCGCATTGTGCAGCGGCACTTGCCCTTTGAGGGTGGCCTGGCCTATGGCATC
GACCAGCTGCTGGAGCCACCTGGCCTTGGTGCTCGCTGTGACCACTTTGAGACCCGGCCC
CTGCGACTGAACACCTGCAGCATCTGTGGGCTGGAGCCACCCTGTCCTGAGGGGTCACAG
GAGCAGGGCAGCCCTGAGGCCTGCTGGCGCTTCTACCCGAAGTTCTGGACGTCCCCTCCG
CTGCACTCTTTGGGATTACGCAGCGTCTGGGTCCACCCCAGCCTTTGGGGTAGGCCCCAA
GGCCTGGGCAGGGGCTGCCACCGCAATTGTGTCACCACCACCTGGAAGCCCAGCTGCTGC
CCTGGTCACTATGGCAGTGAGTGCCAAGCTTGCCCTGGCGGCCCCAGCAGCCCTTGTAGT
GACCGTGGCGTGTGCATGGACGGCATGAGTGGCAGTGGGCAGTGTCTGTGCCGTTCAGGT
TTTGCTGGGACAGCCTGTGAACTCTGTGCTCCTGGTGCCTTTGGGCCCCATTGTCAAGCC
TGCCGCTGCACTGTGCATGGCCGCTGTGATGAGGGCCTTGGGGGCTCTGGCTCCTGCTTC
TGTGATGAAGGCTGGACTGGGCCACGCTGTGAGGTGCAACTGGAGCTGCAGCCTGTGTGT
ACCCCACCCTGTGCACCCGAGGCTGTGTGCCGTGCAGGCAACAGCTGTGAGTGCAGCCTG
GGCTATGAAGGGGATGGCCGTGTGTGTACAGTGGCAGACCTGTGCCAGGACGGGCATGGT
GGCTGCAGTGAGCACGCCAACTGTAGCCAGGTAGGAACAATGGTCACTTGTACCTGCCTG
CCCGACTACGAGGGTGATGGCTGGAGCTGCCGGGCCCGCAACCCCTGCACAGATGGCCAC
CGCGGGGGCTGCAGCGAGCACGCCAACTGCTTGAGCACCGGCCTGAACACACGGCGCTGT
GAGTGCCACGCAGGCTACGTAGGCGATGGACTGCAGTGTCTGGAGGAGTCGGAACCACCT
GTGGACCGCTGCTTGGGCCAGCCACCGCCCTGCCACTCAGATGCCATGTGCACTGACCTG
CACTTCCAGGAGAAACGGGCTGGCGTTTTCCACCTCCAGGCCACCAGCGGCCCTTATGGT
CTGAACTTTTCGGAGGCTGAGGCGGCATGCGAAGCACAGGGAGCCGTCCTTGCTTCATTC
CCTCAGCTCTCTGCTGCCCAGCAGCTGGGCTTCCACCTGTGCCTCATGGGCTGGCTGGCC
AATGGCTCCACTGCCCACCCTGTGGTTTTCCCTGTGGCGGACTGTGGCAATGGTCGGGTG
GGCATAGTCAGCCTGGGTGCCCGCAAGAACCTCTCAGAACGCTGGGATGCCTACTGCTTC
CGTGTGCAAGATGTGGCCTGCCGATGCCGAAATGGCTTCGTGGGTGACGGGATCAGCACG
TGCAATGGGAAGCTGCTGGATGTGCTGGCTGCCACTGCCAACTTCTCCACCTTCTATGGG
ATGCTATTGGGCTATGCCAATGCCACCCAGCGGGGTCTCGACTTCCTGGACTTCCTGGAT
GATGAGCTCACGTATAAGACACTCTTCGTCCCTGTCAATGAAGGCTTTGTGGACAACATG
ACGCTGAGTGGCCCAGACTTGGAGCTGCATGCCTCCAACGCCACCCTCCTAAGTGCCAAC
GCCAGCCAGGGGAAGTTGCTTCCGGCCCACTCAGGCCTCAGCCTCATCATCAGTGACGCA
GGCCCTGACAACAGTTCCTGGGCCCCTGTGGCCCCAGGGACAGTTGTGGTTAGCCGTATC
ATTGTGTGGGACATCATGGCCTTCAATGGCATCATCCATGCTCTGGCCAGCCCCCTCCTG
GCACCCCCACAGCCCCAGGCAGTGCTGGCGCCTGAAGCCCCACCTGTGGCGGCAGGCGTG
GGGGCTGTGCTTGCCGCTGGAGCACTGCTTGGCTTGGTGGCCGGAGCTCTCTACCTCCGT
GCCCGAGGCAAGCCCATGGGCTTTGGCTTCTCTGCCTTCCAGGCGGAAGATGATGCTGAT
GACGACTTCTCACCGTGGCAAGAAGGGACCAACCCCACCCTGGTCTCTGTCCCCAACCCT
GTCTTTGGCAGCGACACCTTTTGTGAACCCTTCGATGACTCACTGCTGGAGGAGGACTTC
CCTGACACCCAGAGGATCCTCACAGTCAAGTGA
Protein Properties
Number of Residues 2570
Molecular Weight 275479.9
Theoretical pI 6.48
Pfam Domain Function
Signals
  • 1-25
Transmembrane Regions
  • 2479-2499
Protein Sequence
>Stabilin-1
MAGPRGLLPLCLLAFCLAGFSFVRGQVLFKGCDVKTTFVTHVPCTSCAAIKKQTCPSGWL
RELPDQITQDCRYEVQLGGSMVSMSGCRRKCRKQVVQKACCPGYWGSRCHECPGGAETPC
NGHGTCLDGMDRNGTCVCQENFRGSACQECQDPNRFGPDCQSVCSCVHGVCNHGPRGDGS
CLCFAGYTGPHCDQELPVCQELRCPQNTQCSAEAPSCRCLPGYTQQGSECRAPNPCWPSP
CSLLAQCSVSPKGQAQCHCPENYHGDGMVCLPKDPCTDNLGGCPSNSTLCVYQKPGQAFC
TCRPGLVSINSNASAGCFAFCSPFSCDRSATCQVTADGKTSCVCRESEVGDGRACYGHLL
HEVQKATQTGRVFLQLRVAVAMMDQGCREILTTAGPFTVLVPSVSSFSSRTMNASLAQQL
CRQHIIAGQHILEDTRTQQTRRWWTLAGQEITVTFNQFTKYSYKYKDQPQQTFNIYKANN
IAANGVFHVVTGLRWQAPSGTPGDPKRTIGQILASTEAFSRFETILENCGLPSILDGPGP
FTVFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKLISKGRILTMAN
QVLAVNISEEGRILLGPEGVPLQRVDVMAANGVIHMLDGILLPPTILPILPKHCSEEQHK
IVAGSCVDCQALNTSTCPPNSVKLDIFPKECVYIHDPTGLNVLKKGCASYCNQTIMEQGC
CKGFFGPDCTQCPGGFSNPCYGKGNCSDGIQGNGACLCFPDYKGIACHICSNPNKHGEQC
QEDCGCVHGLCDNRPGSGGVCQQGTCAPGFSGRFCNESMGDCGPTGLAQHCHLHARCVSQ
EGVARCRCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGSLGTHHCTCHKGWSGDGR
VCVAIDECELDMRGGCHTDALCSYVGPGQSRCTCKLGFAGDGYQCSPIDPCRAGNGGCHG
LATCRAVGGGQRVCTCPPGFGGDGFSCYGDIFRELEANAHFSIFYQWLKSAGITLPADRR
VTALVPSEAAVRQLSPEDRAFWLQPRTLPNLVRAHFLQGALFEEELARLGGQEVATLNPT
TRWEIRNISGRVWVQNASVDVADLLATNGVLHILSQVLLPPRGDVPGGQGLLQQLDLVPA
FSLFRELLQHHGLVPQIEAATAYTIFVPTNRSLEAQGNSSHLDADTVRHHVVLGEALSME
TLRKGGHRNSLLGPAHWIVFYNHSGQPEVNHVPLEGPMLEAPGRSLIGLSGVLTVGSSRC
LHSHAEALREKCVNCTRRFRCTQGFQLQDTPRKSCVYRSGFSFSRGCSYTCAKKIQVPDC
CPGFFGTLCEPCPGGLGGVCSGHGQCQDRFLGSGECHCHEGFHGTACEVCELGRYGPNCT
GVCDCAHGLCQEGLQGDGSCVCNVGWQGLRCDQKITSPQCPRKCDPNANCVQDSAGASTC
ACAAGYSGNGIFCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYMGDGELCQEINS
CLIHHGGCHIHAECIPTGPQQVSCSCREGYSGDGIRTCELLDPCSKNNGGCSPYATCKST
GDGQRTCTCDTAHTVGDGLTCRARVGLELLRDKHASFFSLRLLEYKELKGDGPFTIFVPH
ADLMSNLSQDELARIRAHRQLVFRYHVVGCRRLRSEDLLEQGYATALSGHPLRFSEREGS
IYLNDFARVVSSDHEAVNGILHFIDRVLLPPEALHWEPDDAPIPRRNVTAAAQGFGYKIF
SGLLKVAGLLPLLREASHRPFTMLWPTDAAFRALPPDRQAWLYHEDHRDKLAAILRGHMI
RNVEALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGI
DQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQGSPEACWRFYPKFWTSPP
LHSLGLRSVWVHPSLWGRPQGLGRGCHRNCVTTTWKPSCCPGHYGSECQACPGGPSSPCS
DRGVCMDGMSGSGQCLCRSGFAGTACELCAPGAFGPHCQACRCTVHGRCDEGLGGSGSCF
CDEGWTGPRCEVQLELQPVCTPPCAPEAVCRAGNSCECSLGYEGDGRVCTVADLCQDGHG
GCSEHANCSQVGTMVTCTCLPDYEGDGWSCRARNPCTDGHRGGCSEHANCLSTGLNTRRC
ECHAGYVGDGLQCLEESEPPVDRCLGQPPPCHSDAMCTDLHFQEKRAGVFHLQATSGPYG
LNFSEAEAACEAQGAVLASFPQLSAAQQLGFHLCLMGWLANGSTAHPVVFPVADCGNGRV
GIVSLGARKNLSERWDAYCFRVQDVACRCRNGFVGDGISTCNGKLLDVLAATANFSTFYG
MLLGYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLSAN
ASQGKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSRIIVWDIMAFNGIIHALASPLL
APPQPQAVLAPEAPPVAAGVGAVLAAGALLGLVAGALYLRARGKPMGFGFSAFQAEDDAD
DDFSPWQEGTNPTLVSVPNPVFGSDTFCEPFDDSLLEEDFPDTQRILTVK
GenBank ID Protein 22779437
UniProtKB/Swiss-Prot ID Q9NY15
UniProtKB/Swiss-Prot Entry Name STAB1_HUMAN
PDB IDs Not Available
GenBank Gene ID AB052956
GeneCard ID STAB1
GenAtlas ID STAB1
HGNC ID HGNC:18628
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  5. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  6. Nagase T, Seki N, Ishikawa K, Ohira M, Kawarabayasi Y, Ohara O, Tanaka A, Kotani H, Miyajima N, Nomura N: Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain. DNA Res. 1996 Oct 31;3(5):321-9, 341-54. [PubMed:9039502 ]
  7. Politz O, Gratchev A, McCourt PA, Schledzewski K, Guillot P, Johansson S, Svineng G, Franke P, Kannicht C, Kzhyshkowska J, Longati P, Velten FW, Johansson S, Goerdt S: Stabilin-1 and -2 constitute a novel family of fasciclin-like hyaluronan receptor homologues. Biochem J. 2002 Feb 15;362(Pt 1):155-64. [PubMed:11829752 ]
  8. Adachi H, Tsujimoto M: FEEL-1, a novel scavenger receptor with in vitro bacteria-binding and angiogenesis-modulating activities. J Biol Chem. 2002 Sep 13;277(37):34264-70. Epub 2002 Jun 19. [PubMed:12077138 ]
  9. Kzhyshkowska J, Mamidi S, Gratchev A, Kremmer E, Schmuttermaier C, Krusell L, Haus G, Utikal J, Schledzewski K, Scholtze J, Goerdt S: Novel stabilin-1 interacting chitinase-like protein (SI-CLP) is up-regulated in alternatively activated macrophages and secreted via lysosomal pathway. Blood. 2006 Apr 15;107(8):3221-8. Epub 2005 Dec 15. [PubMed:16357325 ]