You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10906
Secondary Accession Numbers
  • 17207
Name Zinc finger protein OZF
Synonyms
  1. Only zinc finger protein
  2. Zinc finger protein 146
Gene Name ZNF146
Protein Type Unknown
Biological Properties
General Function Involved in zinc ion binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
nucleic acid binding
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.1
SNPs ZNF146
Gene Sequence
>879 bp
ATGTCACACCTCAGCCAGCAGAGAATTTACAGTGGGGAAAACCCCTTTGCCTGTAAGGTA
TGTGGAAAAGTCTTCAGCCACAAATCAAACCTCACTGAGCATGAGCATTTTCACACGAGA
GAGAAACCTTTTGAATGTAACGAGTGTGGAAAAGCCTTTAGCCAAAAGCAGTATGTCATT
AAACATCAGAACACCCATACTGGCGAGAAGCTTTTCGAATGTAATGAATGTGGAAAATCA
TTTAGCCAGAAGGAAAACCTCCTTACGCACCAGAAAATTCACACTGGAGAAAAACCTTTT
GAGTGTAAAGATTGCGGGAAAGCTTTCATTCAGAAGTCAAACCTCATCAGACACCAGAGA
ACTCACACAGGAGAGAAGCCCTTTGTATGTAAGGAGTGTGGAAAAACCTTCAGTGGCAAA
TCCAACCTTACTGAGCATGAGAAAATCCATATTGGAGAGAAGCCTTTTAAATGTAGTGAA
TGTGGAACAGCCTTTGGCCAGAAGAAGTACCTCATAAAACATCAGAACATTCACACTGGA
GAGAAACCCTATGAATGTAACGAATGTGGAAAAGCCTTCTCTCAGCGAACATCACTTATT
GTACATGTGAGGATTCATTCAGGTGATAAACCTTACGAATGCAATGTTTGTGGAAAAGCC
TTCTCTCAGAGCTCATCTCTCACTGTGCATGTGAGAAGCCATACAGGGGAGAAGCCCTAT
GGTTGTAATGAATGTGGGAAAGCTTTCTCTCAGTTCTCAACCCTTGCTCTGCATTTGAGA
ATACACACAGGTAAGAAGCCTTATCAGTGCAGTGAATGTGGGAAAGCTTTCAGCCAGAAG
TCACACCACATTAGACACCAGAAAATTCATACTCACTAA
Protein Properties
Number of Residues 292
Molecular Weight 33307.7
Theoretical pI 9.1
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger protein OZF
MSHLSQQRIYSGENPFACKVCGKVFSHKSNLTEHEHFHTREKPFECNECGKAFSQKQYVI
KHQNTHTGEKLFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFIQKSNLIRHQR
THTGEKPFVCKECGKTFSGKSNLTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTG
EKPYECNECGKAFSQRTSLIVHVRIHSGDKPYECNVCGKAFSQSSSLTVHVRSHTGEKPY
GCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKIHTH
GenBank ID Protein 153791687
UniProtKB/Swiss-Prot ID Q15072
UniProtKB/Swiss-Prot Entry Name OZF_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001099638.1
GeneCard ID ZNF146
GenAtlas ID ZNF146
HGNC ID HGNC:12931
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Le Chalony C, Prosperi MT, Haluza R, Apiou F, Dutrillaux B, Goubin G: The OZF gene encodes a protein consisting essentially of zinc finger motifs. J Mol Biol. 1994 Feb 18;236(2):399-404. [PubMed:8107129 ]
  4. Pibouin L, Villaudy J, Prosperi MT, Goubin G: Genomic organization and promoter identification of ZNF146, a gene encoding a protein consisting solely of zinc finger domains. Cytogenet Cell Genet. 2001;92(1-2):80-4. [PubMed:11306801 ]
  5. Ferbus D, Le Chalony C, Prosperi MT, Muleris M, Vincent-Salomon A, Goubin G: Identification, nuclear localization, and binding activities of OZF, a human protein solely composed of zinc-finger motifs. Eur J Biochem. 1996 Mar 15;236(3):991-5. [PubMed:8665923 ]
  6. Ferbus D, Flechon A, Muleris M, Li Y, Hanash S, Terris B, Hammel P, Pibouin L, Dutrillaux B, Goubin G: Amplification and over-expression of OZF, a gene encoding a zinc finger protein, in human pancreatic carcinomas. Int J Cancer. 1999 Jan 29;80(3):369-72. [PubMed:9935176 ]
  7. Ferbus D, Bovin C, Validire P, Goubin G: The zinc finger protein OZF (ZNF146) is overexpressed in colorectal cancer. J Pathol. 2003 Jun;200(2):177-82. [PubMed:12754738 ]
  8. Antoine K, Ferbus D, Kolahgar G, Prosperi MT, Goubin G: Zinc finger protein overexpressed in colon carcinoma interacts with the telomeric protein hRap1. J Cell Biochem. 2005 Jul 1;95(4):763-8. [PubMed:15838871 ]
  9. Antoine K, Prosperi MT, Ferbus D, Boule C, Goubin G: A Kruppel zinc finger of ZNF 146 interacts with the SUMO-1 conjugating enzyme UBC9 and is sumoylated in vivo. Mol Cell Biochem. 2005 Mar;271(1-2):215-23. [PubMed:15881673 ]