You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10912
Secondary Accession Numbers
  • 17213
Name Zinc finger Y-chromosomal protein
Synonyms Not Available
Gene Name ZFY
Protein Type Unknown
Biological Properties
General Function Involved in DNA binding
Specific Function Probable transcriptional activator
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
transcription regulator activity
nucleic acid binding
dna binding
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs ZFY
Gene Sequence
>2406 bp
ATGGATGAAGATGAATTTGAATTGCAGCCACAAGAGCCAAACTCATTTTTTGATGGAATA
GGAGCTGATGCTACACACATGGATGGTGATCAGATTGTTGTGGAAATACAAGAAGCAGTT
TTTGTTTCTAATATTGTGGATTCTGACATAACTGTGCATAACTTTGTTCCTGATGACCCA
GACTCAGTTGTAATCCAAGATGTTGTTGAAGATGTTGTCATAGAGGAGGATGTTCAGTGC
TCAGATATCTTAGAAGAGGCAGATGTATCTGAAAATGTCATCATTCCTGAGCAAGTGCTG
GACTCAGATGTAACTGAAGAAGTTTCTTTACCACACTGCACAGTCCCAGATGATGTTTTA
GCTTCTGACATTACTTCAACCTCAATGTCTATGCCAGAACATGTTTTAACGAGTGAATCC
ATGCATGTGTGTGACATTGGACATGTTGAACATATGGTGCATGATAGTGTAGTGGAAGCA
GAAATCATTACTGATCCTCTGACGAGTGACATAGTTTCAGAAGAAGTATTGGTAGCAGAC
TGTGCCCCTGAAGCAGTCATAGATGCCAGCGGGATCTCAGTGGACCAGCAAGATAATGAC
AAAGCCAGCTGTGAGGACTACCTAATGATTTCGTTGGATGATGCTGGCAAAATAGAACAT
GATGGTTCCACTGGAGTGACCATCGATGCAGAATCAGAAATGGATCCTTGTAAAGTGGAT
AGCACTTGTCCTGAAGTCATCAAGGTGTACATTTTTAAAGCTGACCCTGGAGAAGATGAC
TTAGGTGGAACTGTAGACATTGTGGAGAGTGAACCTGAAAATGATCATGGAGTTGAACTA
CTTGATCAGAACAGCAGTATTCGTGTTCCCAGGGAAAAGATGGTTTATATGACTGTCAAT
GACTCTCAACAAGAAGATGAAGATTTAAATGTTGCTGAAATTGCTGATGAAGTTTATATG
GAAGTGATCGTAGGAGAGGAGGATGCTGCTGTTGCAGCAGCAGCAGCTGCTGTGCATGAG
CAGCAAATTGATGAGGATGAAATGAAAACCTTCGTACCAATTGCATGGGCAGCAGCTTAT
GGTAATAATTCTGATGGAATTGAAAACCGGAATGGCACTGCAAGTGCCCTCTTGCACATA
GATGAGTCTGCTGGCCTTGGCAGACTGGCTAAACAGAAACCAAAGAAAAAGAGAAGACCT
GATTCCAGGCAGTACCAAACAGCAATAATTATTGGCCCTGATGGTCATCCTTTGACTGTC
TATCCTTGCATGATTTGTGGGAAGAAGTTTAAGTCGAGGGGTTTTTTGAAAAGACACATG
AAAAACCATCCTGAACACCTTGCCAAGAAGAAGTACCACTGTACTGACTGTGATTACACT
ACCAATAAGAAGATAAGTTTACATAACCACCTGGAGAGCCACAAGCTGACCAGCAAGGCA
GAGAAGGCCATTGAATGTGATGAGTGTGGGAAGCATTTTTCTCATGCAGGGGCTTTGTTT
ACTCACAAAATGGTGCATAAGGAAAAAGGGGCCAACAAAATGCACAAGTGTAAATTCTGT
GAATATGAGACAGCTGAACAGGGGTTATTGAATCGCCACCTCTTGGCAGTCCACAGCAAG
AACTTTCCTCATATTTGTGTGGAGTGTGGTAAAGGTTTCCGACACCCGTCGGAACTGAGA
AAGCACATGCGAATCCATACCGGCGAGAAGCCATACCAATGCCAGTACTGTGAATATAGG
TCTGCAGACTCTTCTAACTTGAAAACACATATAAAAACAAAGCATAGTAAAGAGATGCCA
TTCAAGTGTGACATTTGTCTTCTGACTTTCTCAGATACCAAAGAAGTGCAGCAACATACT
CTTGTCCACCAAGAAAGCAAAACACATCAGTGTTTGCATTGCGACCACAAGAGTTCAAAC
TCAAGTGATTTGAAACGACATGTAATTTCAGTTCATACGAAAGACTATCCTCATAAGTGT
GAGATGTGCGAGAAAGGCTTTCACAGGCCTTCAGAACTTAAGAAACATGTGGCTGTCCAC
AAAGGTAAAAAAATGCACCAATGTAGACATTGTGACTTTAAGATTGCAGACCCATTTGTT
CTAAGTCGCCATATTCTCTCAGTTCACACAAAGGATCTTCCATTTAGGTGTAAGAGATGT
AGAAAGGGATTTAGGCAACAAAATGAGCTTAAAAAGCATATGAAGACACACAGTGGCAGG
AAAGTATATCAGTGTGAGTACTGTGAGTATAGCACTACAGATGCCTCAGGCTTTAAACGG
CACGTTATTTCCATTCATACAAAAGACTATCCTCATCGGTGTGAGTACTGCAAGAAAGGC
TTCCGAAGACCTTCAGAAAAGAACCAGCACATAATGAGACACCATAAAGAAGTTGGTCTG
CCCTAA
Protein Properties
Number of Residues 801
Molecular Weight 90504.3
Theoretical pI 5.99
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger Y-chromosomal protein
MDEDEFELQPQEPNSFFDGIGADATHMDGDQIVVEIQEAVFVSNIVDSDITVHNFVPDDP
DSVVIQDVVEDVVIEEDVQCSDILEEADVSENVIIPEQVLDSDVTEEVSLPHCTVPDDVL
ASDITSTSMSMPEHVLTSESMHVCDIGHVEHMVHDSVVEAEIITDPLTSDIVSEEVLVAD
CAPEAVIDASGISVDQQDNDKASCEDYLMISLDDAGKIEHDGSTGVTIDAESEMDPCKVD
STCPEVIKVYIFKADPGEDDLGGTVDIVESEPENDHGVELLDQNSSIRVPREKMVYMTVN
DSQQEDEDLNVAEIADEVYMEVIVGEEDAAVAAAAAAVHEQQIDEDEMKTFVPIAWAAAY
GNNSDGIENRNGTASALLHIDESAGLGRLAKQKPKKKRRPDSRQYQTAIIIGPDGHPLTV
YPCMICGKKFKSRGFLKRHMKNHPEHLAKKKYHCTDCDYTTNKKISLHNHLESHKLTSKA
EKAIECDECGKHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHLLAVHSK
NFPHICVECGKGFRHPSELRKHMRIHTGEKPYQCQYCEYRSADSSNLKTHIKTKHSKEMP
FKCDICLLTFSDTKEVQQHTLVHQESKTHQCLHCDHKSSNSSDLKRHVISVHTKDYPHKC
EMCEKGFHRPSELKKHVAVHKGKKMHQCRHCDFKIADPFVLSRHILSVHTKDLPFRCKRC
RKGFRQQNELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEYCKKG
FRRPSEKNQHIMRHHKEVGLP
GenBank ID Protein 4314425
UniProtKB/Swiss-Prot ID P08048
UniProtKB/Swiss-Prot Entry Name ZFY_HUMAN
PDB IDs Not Available
GenBank Gene ID AC006157
GeneCard ID ZFY
GenAtlas ID ZFY
HGNC ID HGNC:12870
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Skaletsky H, Kuroda-Kawaguchi T, Minx PJ, Cordum HS, Hillier L, Brown LG, Repping S, Pyntikova T, Ali J, Bieri T, Chinwalla A, Delehaunty A, Delehaunty K, Du H, Fewell G, Fulton L, Fulton R, Graves T, Hou SF, Latrielle P, Leonard S, Mardis E, Maupin R, McPherson J, Miner T, Nash W, Nguyen C, Ozersky P, Pepin K, Rock S, Rohlfing T, Scott K, Schultz B, Strong C, Tin-Wollam A, Yang SP, Waterston RH, Wilson RK, Rozen S, Page DC: The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes. Nature. 2003 Jun 19;423(6942):825-37. [PubMed:12815422 ]
  3. Lau YF, Chan KM: The putative testis-determining factor and related genes are expressed as discrete-sized transcripts in adult gonadal and somatic tissues. Am J Hum Genet. 1989 Dec;45(6):942-52. [PubMed:2511751 ]
  4. Palmer MS, Berta P, Sinclair AH, Pym B, Goodfellow PN: Comparison of human ZFY and ZFX transcripts. Proc Natl Acad Sci U S A. 1990 Mar;87(5):1681-5. [PubMed:2308929 ]
  5. Erlandsson R, Wilson JF, Paabo S: Sex chromosomal transposable element accumulation and male-driven substitutional evolution in humans. Mol Biol Evol. 2000 May;17(5):804-12. [PubMed:10779541 ]
  6. Page DC, Mosher R, Simpson EM, Fisher EM, Mardon G, Pollack J, McGillivray B, de la Chapelle A, Brown LG: The sex-determining region of the human Y chromosome encodes a finger protein. Cell. 1987 Dec 24;51(6):1091-104. [PubMed:3690661 ]
  7. North M, Sargent C, O'Brien J, Taylor K, Wolfe J, Affara NA, Ferguson-Smith MA: Comparison of ZFY and ZFX gene structure and analysis of alternative 3' untranslated regions of ZFY. Nucleic Acids Res. 1991 May 25;19(10):2579-86. [PubMed:2041734 ]
  8. Affara NA, Chambers D, O'Brien J, Habeebu SS, Kalaitsidaki M, Bishop CE, Ferguson-Smith MA: Evidence for distinguishable transcripts of the putative testis determining gene (ZFY) and mapping of homologous cDNA sequences to chromosomes X,Y and 9. Nucleic Acids Res. 1989 Apr 25;17(8):2987-99. [PubMed:2498838 ]
  9. Kochoyan M, Havel TF, Nguyen DT, Dahl CE, Keutmann HT, Weiss MA: Alternating zinc fingers in the human male associated protein ZFY: 2D NMR structure of an even finger and implications for "jumping-linker" DNA recognition. Biochemistry. 1991 Apr 9;30(14):3371-86. [PubMed:1849423 ]
  10. Kochoyan M, Keutmann HT, Weiss MA: Alternating zinc fingers in the human male associated protein ZFY: refinement of the NMR structure of an even finger by selective deuterium labeling and implications for DNA recognition. Biochemistry. 1991 Jul 23;30(29):7063-72. [PubMed:1854720 ]