You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10916
Secondary Accession Numbers
  • 17217
Name Zinc finger protein 346
Synonyms
  1. Just another zinc finger protein
Gene Name ZNF346
Protein Type Unknown
Biological Properties
General Function Involved in zinc ion binding
Specific Function Binds to dsRNA and DNA
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
nucleic acid binding
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. nucleolus
Gene Properties
Chromosome Location Chromosome:5
Locus 5q35.2
SNPs ZNF346
Gene Sequence
>885 bp
ATGGAGTATCCCGCGCCGGCCACGGTGCAGGCCGCGGACGGCGGAGCGGCCGGGCCTTAC
AGCAGCTCGGAGTTGCTGGAGGGCCAGGAGCCGGACGGGGTGCGCTTTGACCGCGAGAGG
GCGCGCCGCCTGTGGGAAGCCGTGTCCGGTGCCCAGCCGGTGGGTAGAGAGGAAGTGGAG
CACATGATCCAGAAGAACCAATGTCTCTTCACCAACACCCAGTGTAAGGTTTGCTGCGCC
TTGCTTATTTCTGAGTCCCAGAAGCTGGCACATTACCAGAGCAAAAAACATGCCAACAAA
GTGAAGAGATACCTAGCAATCCATGGAATGGAGACATTAAAGGGGGAAACGAAGAAGCTA
GACTCAGATCAGAAGAGCAGCAGAAGCAAAGACAAGAACCAGTGCTGCCCCATCTGTAAC
ATGACCTTTTCCTCCCCTGTCGTGGCCCAGTCGCACTACCTGGGGAAGACCCACGCAAAG
AACTTAAAGCTGAAGCAGCAGTCCACTAAGGTGGAAGCCTTGCACCAGAATAGAGAGATG
ATAGACCCAGACAAGTTCTGCAGCCTCTGCCATGCAACTTTCAACGACCCTGTCATGGCT
CAACAACATTATGTGGGCAAGAAACACAGAAAACAGGAGACCAAGCTCAAACTAATGGCA
CGCTATGGGCGGCTGGCGGACCCTGCTGTCACTGACTTTCCAGCTGGAAAGGGCTACCCC
TGCAAAACATGTAAGATAGTGCTGAACTCCATAGAACAGTACCAAGCTCATGTCAGCGGC
TTCAAACACAAGAACCAGTCACCAAAAACAGTGGCATCATCCCTGGGCCAGATTCCAATG
CAAAGGCAACCCATTCAGAAAGACTCAACCACCTTGGAAGACTAG
Protein Properties
Number of Residues 294
Molecular Weight 32932.4
Theoretical pI 9.48
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger protein 346
MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVE
HMIQKNQCLFTNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKL
DSDQKSSRSKDKNQCCPICNMTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREM
IDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLADPAVTDFPAGKGYP
CKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLGQIPMQRQPIQKDSTTLED
GenBank ID Protein 5813803
UniProtKB/Swiss-Prot ID Q9UL40
UniProtKB/Swiss-Prot Entry Name ZN346_HUMAN
PDB IDs Not Available
GenBank Gene ID AF083340
GeneCard ID ZNF346
GenAtlas ID ZNF346
HGNC ID HGNC:16403
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Chen T, Brownawell AM, Macara IG: Nucleocytoplasmic shuttling of JAZ, a new cargo protein for exportin-5. Mol Cell Biol. 2004 Aug;24(15):6608-19. [PubMed:15254228 ]
  6. Yang M, May WS, Ito T: JAZ requires the double-stranded RNA-binding zinc finger motifs for nuclear localization. J Biol Chem. 1999 Sep 24;274(39):27399-406. [PubMed:10488071 ]