You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10917
Secondary Accession Numbers
  • 17218
Name Zinc finger E-box-binding homeobox 1
Synonyms
  1. NIL-2-A zinc finger protein
  2. Negative regulator of IL2
  3. TCF-8
  4. Transcription factor 8
Gene Name ZEB1
Protein Type Unknown
Biological Properties
General Function Involved in sequence-specific DNA binding transcription factor activity
Specific Function Inhibits interleukin-2 (IL-2) gene expression. May be responsible for transcriptional repression of the IL-2 gene. Enhances or represses the promoter activity of the ATP1A1 gene depending on the quantity of cDNA and on the cell type
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
nucleic acid binding
dna binding
sequence-specific dna binding
sequence-specific dna binding transcription factor activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 10p11.2
SNPs ZEB1
Gene Sequence
>3375 bp
ATGGCGGATGGCCCCAGGTGTAAGCGCAGAAAGCAGGCGAACCCGCGGCGCAATAACGTT
ACAAATTATAATACTGTGGTAGAAACAAATTCAGATTCAGATGATGAAGACAAACTGCAT
ATTGTGGAAGAAGAAAGTGTTACAGATGCAGCTGACTGTGAAGGTGTACCAGAGGATGAC
CTGCCAACAGACCAGACAGTGTTACCAGGGAGGAGCAGTGAAAGAGAAGGGAATGCTAAG
AACTGCTGGGAGGATGACAGAAAGGAAGGGCAAGAAATCCTGGGGCCTGAAGCTCAGGCA
GATGAAGCAGGATGTACAGTAAAAGATGATGAATGCGAGTCAGATGCAGAAAATGAGCAA
AACCATGATCCTAATGTTGAAGAGTTTCTACAACAACAAGACACTGCTGTCATTTTTCCT
GAGGCACCTGAAGAGGACCAGAGGCAGGGCACACCAGAAGCCAGTGGTCATGATGAAAAT
GGAACACCAGATGCATTTTCACAATTACTCACCTGTCCATATTGTGATAGAGGCTATAAA
CGCTTTACCTCTCTGAAAGAACACATTAAATATCGTCATGAAAAGAATGAAGATAACTTT
AGTTGCTCCCTGTGCAGTTACACCTTTGCATACAGAACCCAACTTGAACGTCACATGACA
TCACATAAATCAGGAAGAGATCAAAGACATGTGACGCAGTCTGGGTGTAATCGTAAATTC
AAATGCACTGAGTGTGGAAAAGCTTTCAAATACAAACATCACCTAAAAGAGCACTTAAGA
ATTCACAGTGGAGAGAAGCCATATGAATGCCCAAACTGCAAGAAACGCTTTTCCCATTCT
GGCTCCTATAGCTCACACATAAGCAGTAAGAAATGTATCAGCTTGATACCTGTGAATGGG
CGACCAAGAACAGGACTCAAGACATCTCAGTGTTCTTCACCGTCTCTTTCAGCATCACCA
GGCAGTCCCACACGACCACAGATACGGCAAAAGATAGAGAATAAACCCCTTCAAGAACAA
CTTTCTGTTAACCAAATTAAAACTGAACCTGTGGATTATGAATTCAAACCCATAGTGGTT
GCTTCAGGAATCAACTGTTCAACCCCTTTACAAAATGGGGTTTTCACTGGTGGTGGCCCA
TTACAGGCAACCAGTTCTCCTCAGGGCATGGTGCAAGCTGTTGTTCTGCCAACAGTTGGT
TTGGTGTCTCCCATAAGTATCAATTTAAGTGATATTCAGAATGTACTTAAAGTGGCGGTA
GATGGTAATGTAATAAGGCAAGTGTTGGAGAATAATCAAGCCAATCTTGCATCCAAAGAA
CAAGAAACAATCAATGCTTCACCCATACAACAAGGTGGCCATTCTGTTATTTCAGCCATC
AGTCTTCCTTTGGTTGATCAAGATGGAACAACCAAAATTATCATCAACTACAGTCTTGAG
CAGCCTAGCCAACTTCAAGTTGTTCCTCAAAATTTAAAAAAAGAAAATCCAGTCGCTACA
AACAGTTGTAAAAGTGAAAAGTTACCAGAAGATCTTACTGTTAAGTCTGAGAAGGACAAA
AGCTTTGAAGGGGGGGTGAATGATAGCACTTGTCTTCTGTGTGATGATTGTCCAGGAGAT
ATTAATGCACTTCCAGAATTAAAGCACTATGACCTAAAGCAGCCTACTCAGCCTCCTCCA
CTCCCTGCAGCAGAAGCTGAGAAGCCTGAGTCCTCTGTTTCATCAGCTACTGGAGATGGC
AATTTGTCTCCTAGTCAGCCACCTTTAAAGAACCTCTTGTCTCTCCTAAAAGCATATTAT
GCTTTGAATGCACAACCAAGTGCAGAAGAGCTCTCAAAAATTGCTGATTCAGTAAACCTA
CCACTGGATGTAGTAAAAAAGTGGTTTGAAAAGATGCAAGCTGGACAGATTTCAGTGCAG
TCTTCTGAACCATCTTCTCCTGAACCAGGCAAAGTAAATATCCCTGCCAAGAACAATGAT
CAGCCTCAATCTGCAAATGCAAATGAACCCCAGGACAGCACAGTAAATCTACAAAGTCCT
TTGAAGATGACTAACTCCCCAGTTTTACCAGTGGGATCAACCACCAATGGTTCCAGAAGT
AGTACACCATCCCCATCACCTCTAAACCTTTCCTCATCCAGAAATACACAGGGTTACTTG
TACACAGCTGAGGGTGCACAAGAAGAGCCACAAGTAGAACCTCTTGATCTTTCACTACCA
AAGCAACAGGGAGAATTATTAGAAAGGTCAACTATCACTAGTGTTTACCAGAACAGTGTT
TATTCTGTCCAGGAAGAACCCTTGAACTTGTCTTGCGCAAAAAAGGAGCCACAAAAGGAC
AGTTGTGTTACAGACTCAGAACCAGTTGTAAATGTAATCCCACCAAGTGCCAACCCCATA
AATATCGCTATACCTACAGTCACTGCCCAGTTACCCACAATCGTGGCCATTGCTGACCAG
AACAGTGTTCCATGCTTAAGAGCGCTAGCTGCCAATAAGCAAACGATTCTGATTCCCCAG
GTGGCATACACCTACTCAACTACGGTCAGCCCTGCAGTCCAAGAACCACCCTTGAAAGTG
ATCCAGCCAAATGGAAATCAGGATGAAAGACAAGATACTAGCTCAGAAGGAGTATCAAAT
GTAGAGGATCAGAATGACTCTGATTCTACACCGCCCAAAAAGAAAATGCGGAAGACAGAA
AATGGAATGTATGCTTGTGATTTGTGTGACAAGATATTCCAAAAGAGTAGTTCATTATTG
AGACATAAATATGAACACACAGGTAAAAGACCTCATGAGTGTGGAATCTGTAAAAAGGCA
TTTAAACACAAACATCATTTGATTGAACACATGCGATTACATTCTGGAGAAAAGCCCTAT
CAATGTGACAAATGTGGAAAGCGCTTCTCACACTCTGGGTCTTATTCTCAACACATGAAT
CATCGCTACTCCTACTGTAAGAGAGAAGCGGAAGAACGTGACAGCACAGAGCAGGAAGAG
GCAGGGCCTGAAATCCTCTCGAATGAGCACGTGGGTGCCAGGGCGTCTCCCTCACAGGGC
GACTCGGACGAGAGAGAGAGTTTGACAAGGGAAGAGGATGAAGACAGTGAAAAAGAGGAA
GAGGAGGAGGATAAAGAGATGGAAGAATTGCAGGAAGAAAAAGAATGTGAAAAACCACAA
GGGGATGAGGAAGAGGAGGAGGAGGAGGAAGAAGTGGAAGAAGAAGAGGTAGAAGAGGCA
GAGAATGAGGGAGAAGAAGCAAAAACTGAAGGTCTGATGAAGGATGACAGGGCTGAAAGT
CAAGCAAGCAGCTTAGGACAAAAAGTAGGCGAGAGTAGTGAGCAAGTGTCTGAAGAAAAG
ACAAATGAAGCCTAA
Protein Properties
Number of Residues 1124
Molecular Weight 124072.6
Theoretical pI 4.59
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger E-box-binding homeobox 1
MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDD
LPTDQTVLPGRSSEREGNAKNCWEDDRKEGQEILGPEAQADEAGCTVKDDECESDAENEQ
NHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGYK
RFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKF
KCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNG
RPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEPVDYEFKPIVV
ASGINCSTPLQNGVFTGGGPLQATSSPQGMVQAVVLPTVGLVSPISINLSDIQNVLKVAV
DGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLE
QPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGD
INALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYY
ALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNND
QPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYL
YTAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQKD
SCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQ
VAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
NGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPY
QCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDSTEQEEAGPEILSNEHVGARASPSQG
DSDERESLTREEDEDSEKEEEEEDKEMEELQEEKECEKPQGDEEEEEEEEEVEEEEVEEA
ENEGEEAKTEGLMKDDRAESQASSLGQKVGESSEQVSEEKTNEA
GenBank ID Protein 55957123
UniProtKB/Swiss-Prot ID P37275
UniProtKB/Swiss-Prot Entry Name ZEB1_HUMAN
PDB IDs Not Available
GenBank Gene ID AL117340
GeneCard ID ZEB1
GenAtlas ID ZEB1
HGNC ID HGNC:11642
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  7. Long J, Zuo D, Park M: Pc2-mediated sumoylation of Smad-interacting protein 1 attenuates transcriptional repression of E-cadherin. J Biol Chem. 2005 Oct 21;280(42):35477-89. Epub 2005 Aug 1. [PubMed:16061479 ]
  8. Watanabe Y, Kawakami K, Hirayama Y, Nagano K: Transcription factors positively and negatively regulating the Na,K-ATPase alpha 1 subunit gene. J Biochem. 1993 Dec;114(6):849-55. [PubMed:8138542 ]
  9. Williams TM, Moolten D, Burlein J, Romano J, Bhaerman R, Godillot A, Mellon M, Rauscher FJ 3rd, Kant JA: Identification of a zinc finger protein that inhibits IL-2 gene expression. Science. 1991 Dec 20;254(5039):1791-4. [PubMed:1840704 ]
  10. Krafchak CM, Pawar H, Moroi SE, Sugar A, Lichter PR, Mackey DA, Mian S, Nairus T, Elner V, Schteingart MT, Downs CA, Kijek TG, Johnson JM, Trager EH, Rozsa FW, Mandal MN, Epstein MP, Vollrath D, Ayyagari R, Boehnke M, Richards JE: Mutations in TCF8 cause posterior polymorphous corneal dystrophy and ectopic expression of COL4A3 by corneal endothelial cells. Am J Hum Genet. 2005 Nov;77(5):694-708. Epub 2005 Sep 14. [PubMed:16252232 ]