You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10924
Secondary Accession Numbers
  • 17225
Name Zinc finger protein 33B
Synonyms
  1. Zinc finger protein 11B
  2. Zinc finger protein KOX2
Gene Name ZNF33B
Protein Type Unknown
Biological Properties
General Function Involved in nucleic acid binding
Specific Function May be involved in transcriptional regulation
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
nucleic acid binding
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 10q11.2
SNPs ZNF33B
Gene Sequence
>2337 bp
ATGAACAAGGTAGATCAGAAGTTCCAGGGGTCAGTATCATTTAAAGATGTGACTGTGGGC
TTCACCCAGGAGGAGTGGCAGCACCTGGACCCTAGTCAGAGGGCTCTGTATAGAGATGTG
ATGCTGGAGAACTACAGCAACCTTGTCTCAGTGGGGTATTGTGCTCACAAACCAGAGGTG
ATCTTCAGGCTGGAACAAGGAGAAGAACCATGGAGACTGGAGGAAGAATTCCCAAGCCAG
AGCTTTCCAGAAGTCTGGACAGCTGATCACCTGAAAGAGAGGAGCCAAGAAAATCAATCT
AAACATTTGTGGGAAGTTGTATTCATCAATAATGAAATGCTGACTAAGGAACAAGGTAAT
GTAATAGGAATACCATTTAACATGGACGTAAGTTCTTTTCCTTCCAGAAAAATGTTCTGT
CAGTATGACTCACGTGGAATGAGTTTCAACACTGTTTCAGAATTGGTTATCAGTAAGATA
AACTATTTAGGAAAAAAGTCTGACGAATTTAATGCATGTGGGAAATTGTTACTCAATATT
AAGCATGATGAAACTCATACTCGAGAGAAAAATGAAGTTTTGAAAAATAGGAACACTCTG
AGTCATCGTGAGAACACTTTGCAGCATGAGAAGATTCAAACTTTAGACCACAATTTTGAA
TACAGTATATGTCAGGAAACCCTCCTTGAAAAGGCAGTATTCAATACACGGAAGAGAGAG
AATGCAGAAGAGAATAACTGTGACTATAATGAATTTGGGAGAACTTTCTGTGATAGTTCA
TCCCTCTTGTTCCATCAGATACCTCCATCAAAGGACAGTCACTATGAATTTAGTGATTGT
GAGAAGTTCTTATGTGTGAAGTCCACCCTTTCTAAACATGATGGGGTACCTGTGAAACAC
TATGATTGTGGTGAAAGTGGGAATAATTTCAGGAGGAAATTGTGTCTGTCACAGCTTCAG
AAAGGTGATAAAGGAGAGAAACACTTTGAATGTAATGAATGTGGGAAAGCTTTCTGGGAG
AAGTCACATCTCACTCGACATCAGAGGGTGCACACAGGAGAGAAACACTTTCAATGTAAT
CAATGTGGAAAAACTTTCTGGGAGAAGTCAAACCTCACTAAACATCAGAGATCACACACA
GGGGAGAAACCTTTTGAATGCAATGAATGTGGGAAAGCCTTTAGCCATAAGTCAGCCCTC
ACATTACACCAGAGAACACATACAGGGGAGAAACCCTATCAGTGTAATGCATGTGGGAAA
ACTTTTTACCAGAAATCTGACCTCACTAAACATCAGAGAACACACACAGGGCAGAAACCC
TATGAATGTTATGAATGTGGAAAATCCTTCTGTATGAATTCACACCTTACAGTACACCAG
AGAACTCACACAGGTGAGAAACCTTTTGAATGTCTTGAGTGTGGGAAATCCTTTTGTCAA
AAGTCACATCTTACACAGCATCAGAGAACTCACATAGGAGATAAACCTTATGAATGTAAT
GCATGTGGGAAAACTTTCTACCACAAGTCAGTACTCACCAGGCATCAGATAATTCATACA
GGGTTGAAACCTTATGAATGTTATGAATGTGGGAAAACCTTCTGCTTGAAGTCAGACCTC
ACAATACATCAGAGAACGCACACAGGGGAGAAACCCTTTGCATGTCCTGAATGTGGGAAA
TTCTTTAGCCATAAGTCAACCCTCTCTCAACATTATAGAACACACACGGGGGAGAAACCC
TATGAATGTCATGAATGTGGAAAAATCTTTTACAATAAATCATACCTAACAAAACATAAT
AGAACACATACAGGGGAGAAACCCTATGAATGTAATGAATGTGGAAAAACCTTCTGCCAG
AAGTCACAACTCACTCAGCATCAGAGAATTCACATAGGGGAGAAACCCTATGAATGTAAT
GAGTGTGGAAAAGCTTTCTGCCATAAGTCAGCTCTAATTGTACATCAGAGAACCCATACA
CAAGAAAAGCCTTATAAATGTAACGAATGTGGAAAATCTTTCTGTGTGAAGTCAGGACTT
ATTTTACATGAGAGAAAGCACACGGGGGAGAAACCCTATGAATGCAATGAATGTGGGAAA
TCCTTCAGTCACAAATCATCACTCACAGTACATCACAGGGCTCACACAGGAGAGAAATCT
TGTCAGTGTAATGAATGTGGAAAAATCTTTTACCGTAAATCAGACCTTGCTAAACATCAG
AGATCACATACAGGGGAAAAGCCCTATGAATGTAACACATGCAGGAAAACCTTCTCTCAA
AAGTCAAATCTCATTGTACATCAGAGAACACACATAGGAGAAAAACCTTATGAATGA
Protein Properties
Number of Residues 778
Molecular Weight 90682.6
Theoretical pI 8.3
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Zinc finger protein 33B
MNKVDQKFQGSVSFKDVTVGFTQEEWQHLDPSQRALYRDVMLENYSNLVSVGYCAHKPEV
IFRLEQGEEPWRLEEEFPSQSFPEVWTADHLKERSQENQSKHLWEVVFINNEMLTKEQGN
VIGIPFNMDVSSFPSRKMFCQYDSRGMSFNTVSELVISKINYLGKKSDEFNACGKLLLNI
KHDETHTREKNEVLKNRNTLSHRENTLQHEKIQTLDHNFEYSICQETLLEKAVFNTRKRE
NAEENNCDYNEFGRTFCDSSSLLFHQIPPSKDSHYEFSDCEKFLCVKSTLSKHDGVPVKH
YDCGESGNNFRRKLCLSQLQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGEKHFQCN
QCGKTFWEKSNLTKHQRSHTGEKPFECNECGKAFSHKSALTLHQRTHTGEKPYQCNACGK
TFYQKSDLTKHQRTHTGQKPYECYECGKSFCMNSHLTVHQRTHTGEKPFECLECGKSFCQ
KSHLTQHQRTHIGDKPYECNACGKTFYHKSVLTRHQIIHTGLKPYECYECGKTFCLKSDL
TIHQRTHTGEKPFACPECGKFFSHKSTLSQHYRTHTGEKPYECHECGKIFYNKSYLTKHN
RTHTGEKPYECNECGKTFCQKSQLTQHQRIHIGEKPYECNECGKAFCHKSALIVHQRTHT
QEKPYKCNECGKSFCVKSGLILHERKHTGEKPYECNECGKSFSHKSSLTVHHRAHTGEKS
CQCNECGKIFYRKSDLAKHQRSHTGEKPYECNTCRKTFSQKSNLIVHQRTHIGEKPYE
GenBank ID Protein 21665857
UniProtKB/Swiss-Prot ID Q06732
UniProtKB/Swiss-Prot Entry Name ZN33B_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ491697
GeneCard ID ZNF33B
GenAtlas ID ZNF33B
HGNC ID HGNC:13097
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  3. Thiesen HJ: Multiple genes encoding zinc finger domains are expressed in human T cells. New Biol. 1990 Apr;2(4):363-74. [PubMed:2288909 ]
  4. Guy J, Hearn T, Crosier M, Mudge J, Viggiano L, Koczan D, Thiesen HJ, Bailey JA, Horvath JE, Eichler EE, Earthrowl ME, Deloukas P, French L, Rogers J, Bentley D, Jackson MS: Genomic sequence and transcriptional profile of the boundary between pericentromeric satellites and genes on human chromosome arm 10p. Genome Res. 2003 Feb;13(2):159-72. [PubMed:12566394 ]
  5. Tunnacliffe A, Liu L, Moore JK, Leversha MA, Jackson MS, Papi L, Ferguson-Smith MA, Thiesen HJ, Ponder BA: Duplicated KOX zinc finger gene clusters flank the centromere of human chromosome 10: evidence for a pericentric inversion during primate evolution. Nucleic Acids Res. 1993 Mar 25;21(6):1409-17. [PubMed:8464732 ]