You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10937
Secondary Accession Numbers
  • 17246
Name Tensin-like C1 domain-containing phosphatase
Synonyms
  1. C1 domain-containing phosphatase and tensin homolog
  2. C1-TEN
  3. Tensin-2
Gene Name TENC1
Protein Type Enzyme
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function Regulates cell motility and proliferation. May have phosphatase activity. Reduces AKT1 phosphorylation. Lowers AKT1 kinase activity and interferes with AKT1 signaling
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location
  1. Cell membrane
  2. Peripheral membrane protein
  3. Cytoplasmic side
  4. Cell junction
  5. focal adhesion
Gene Properties
Chromosome Location Chromosome:1
Locus 12q13.13
SNPs TENC1
Gene Sequence
>4230 bp
ATGAAGTCCAGCGGCCCTGTGGAGAGGCTGCTCAGAGCCCTGGGGAGGAGGGACAGCAGC
CGGGCCGCAAGCAGGCCTAGGAAAGCTGAGCCTCATAGCTTCCGGGAGAAGGTTTTCCGG
AAGAAACCTCCAGTCTGTGCAGTATGTAAGGTGACCATCGATGGGACAGGCGTTTCGTGC
AGAGTCTGCAAGGTGGCGACGCACAGAAAATGTGAAGCAAAGGTGACTTCAGCCTGTCAG
GCCTTGCCTCCCGTGGAGTTGCGGCGAAACACGGCCCCAGTCAGGCGCATAGAGCACCTG
GGATCCACCAAATCTCTGAACCACTCAAAGCAGCGCAGCACTCTGCCCAGGAGCTTCAGC
CTGGACCCGCTCATGGAGCGGCGCTGGGACTTAGACCTCACCTACGTGACGGAGCGCATC
TTGGCCGCCGCCTTCCCCGCGCGGCCCGATGAACAGCGGCACCGGGGCCACCTGCGCGAG
CTGGCCCATGTGCTGCAATCCAAGCACCGGGACAAGTACCTGCTCTTCAACCTTTCAGAG
AAAAGGCATGACCTGACCCGCTTAAACCCCAAGGTTCAAGACTTCGGCTGGCCTGAGCTG
CATGCTCCACCCCTGGACAAGCTGTGCTCCATCTGCAAAGCCATGGAGACATGGCTCAGT
GCTGACCCACAGCACGTGGTCGTACTATACTGCAAGGGAAACAAGGGCAAGCTTGGGGTC
ATCGTTTCTGCCTACATGCACTACAGCAAGATCTCTGCAGGGGCGGACCAGGCACTGGCC
ACTCTTACCATGCGGAAATTCTGCGAGGACAAGGTGGCCACAGAACTGCAGCCCTCCCAG
CGTCGATATATCAGCTACTTCAGTGGGCTGCTATCTGGCTCCATCAGAATGAACAGCAGC
CCTCTCTTCCTGCACTATGTGCTCATCCCCATGCTGCCAGCCTTTGAACCTGGCACAGGC
TTCCAGCCCTTCCTTAAAATCTACCAGTCCATGCAGCTTGTCTACACATCTGGAGTCTAT
CACATTGCAGGCCCTGGTCCCCAGCAGCTTTGCATCAGCCTGGAGCCAGCCCTCCTCCTC
AAAGGCGATGTCATGGTAACATGTTATCACAAGGGTGGCCGGGGCACAGACCGGACCCTC
GTGTTCCGAGTCCAGTTCCACACCTGCACCATCCACGGACCACAGCTCACTTTCCCCAAG
GACCAGCTTGACGAGGCCTGGACTGATGAGAGGTTCCCCTTCCAAGCCTCCGTGGAGTTT
GTCTTCTCCTCCAGCCCCGAGAAGATCAAAGGCAGCACTCCACGGAACGACCCCTCGGTC
TCTGTCGACTACAACACCACTGAGCCAGCCGTGCGCTGGGACTCCTATGAGAACTTCAAC
CAGCACCACGAGGACAGTGTGGATGGCTCCTTGACCCACACCCGGGGTCCCCTGGATGGC
AGTCCTTATGCCCAGGTGCAGCGGCCTCCCCGGCAGACCCCCCCGGCACCCTCTCCAGAG
CCTCCACCACCCCCCATGCTCTCTGTCAGCAGCGACTCAGGCCATTCCTCCACGCTGACC
ACAGAGCCGGCTGCTGAGTCCCCTGGCCGGCCGCCCCCTACAGCTGCTGAACGGCAGGAG
CTGGATCGCCTCCTAGGAGGCTGCGGAGTGGCCAGTGGGGGCCGGGGAGCTGGGCGCGAG
ACGGCCATCCTAGATGACGAAGAGCAGCCCACTGTGGGCGGAGGCCCCCACCTCGGAGTG
TATCCAGGCCATAGGCCTGGCCTCAGCCGCCACTGCTCCTGCCGCCAGGGCTACCGGGAG
CCCTGCGGGGTTCCCAATGGGGGCTACTACCGGCCAGAGGGAACCCTGGAGAGGAGGCGA
CTGGCCTACGGGGGCTATGAGGGATCCCCCCAGGGCTACGCCGAGGCCTCGATGGAGAAG
AGGCGCCTCTGCCGATCGCTGTCAGAGGGGCTATACCCCTACCCACCTGAGATGGGGAAA
CCAGCCACTGGGGACTTTGGCTACCGCGCCCCAGGCTACCGGGAGGTGGTCATCCTGGAG
GACCCTGGGCTGCCTGCCCTATACCCATGCCCAGCCTGCGAGGAGAAGCTGGCGCTGCCT
ACAGCAGCCTTGTATGGACTGCGGCTGGAGAGGGAGGCTGGAGAAGGGTGGGCAAGTGAG
GCTGGCAAGCCTCTCCTGCACCCAGTGCGGCCTGGGCACCCGCTGCCTCTGCTCTTGCCT
GCCTGTGGGCATCACCATGCCCCGATGCCTGACTACAGCTGCCTGAAGCCACCCAAGGCA
GGCGAGGAAGGGCACGAGGGCTGCTCCTACACCATGTGCCCCGAAGGCAGGTATGGGCAT
CCAGGGTACCCTGCCCTGGTGACATACAGCTATGGAGGAGCAGTTCCCAGTTACTGCCCA
GCATATGGCCGTGTGCCTCATAGCTGTGGCTCTCCAGGAGAGGGCAGAGGGTATCCCAGC
CCTGGTGCCCACTCCCCACGGGCTGGCTCCATTTCCCCGGGCAGCCCGCCCTATCCACAA
TCTAGGAAGCTGAGCTACGAGATCCCTACGGAGGAGGGAGGGGACAGGTACCCATTGCCT
GGGCACCTGGCCTCAGCAGGACCTTTGGCATCTGCAGAGTCGCTGGAGCCGGTGTCCTGG
AGGGAGGGCCCCAGTGGGCACAGCACACTGCCTCGGTCTCCCCGAGATGCCCCATGCAGT
GCTTCGTCAGAGTTGTCTGGTCCCTCCACGCCCCTGCACACCAGCAGTCCAGTCCAGGGC
AAGGAAAGCACCCGGCGACAGGACACCAGGTCCCCCACCTCAGCGCCCACTCAGAGACTG
AGTCCTGGCGAGGCCTTGCCCCCTGTTTCCCAGGCAGGCACCGGAAAGGCCCCTGAGCTG
CCGTCGGGAAGTGGGCCTGAGCCTCTGGCCCCTAGCCCAGTCTCTCCGACCTTCCCTCCC
AGCTCGCCCAGTGACTGGCCTCAGGAAAGGAGTCCAGGGGGCCACTCAGATGGCGCCAGT
CCTCGGAGCCCTGTGCCCACCACACTTCCTGGCCTCCGCCACGCCCCCTGGCAAGGCCCT
CGAGGCCCCCCCGACAGCCCAGATGGGTCTCCCCTCACTCCTGTGCCTTCCCAGATGCCC
TGGCTTGTGGCCAGCCCAGAGCCGCCTCAGAGCTCACCTACACCTGCTTTCCCCCTGGCT
GCCTCCTATGACACCAATGGCCTTAGCCAGCCCCCACTTCCTGAGAAACGCCACCTGCCC
GGGCCGGGGCAACAGCCAGGACCCTGGGGCCCAGAGCAGGCATCATCGCCAGCCAGAGGC
ATCAGTCACCATGTCACCTTCGCACCTCTGCTCTCAGATAATGTCCCCCAAACCCCAGAG
CCTCCTACACAAGAGAGCCAAAGCAATGTCAAGTTTGTCCAGGATACATCCAAGTTCTGG
TACAAGCCACACCTGTCCCGTGACCAAGCCATTGCCCTGCTGAAGGACAAGGACCCTGGG
GCCTTCCTGATCAGGGACAGTCATTCATTCCAAGGAGCTTATGGGCTGGCCCTCAAGGTG
GCCACACCGCCACCCAGTGCCCAGCCCTGGAAAGGGGACCCCGTGGAACAGCTGGTCCGC
CATTTCCTCATCGAGACTGGGCCCAAAGGGGTGAAGATCAAGGGCTGCCCCAGTGAGCCC
TACTTTGGCAGCCTGTCCGCCTTGGTCTCCCAGCACTCCATCTCCCCCATCTCCCTGCCC
TGCTGCCTGCGCATTCCCAGCAAAGATCCTCTGGAAGAGACCCCAGAGGCTCCAGTGCCC
ACCAACATGAGCACAGCGGCAGACCTCCTGCGTCAGGGTGCTGCCTGCAGCGTGCTCTAC
TTGACCTCAGTGGAGACAGAGTCACTGACGGGCCCCCAAGCTGTGGCCCGGGCCAGCTCT
GCAGCTCTGAGCTGTAGCCCCCGCCCGACACCAGCTGTTGTCCACTTCAAGGTGTCAGCC
CAGGGCATTACACTGACGGACAACCAAAGGAAGCTCTTCTTTCGCCGCCATTATCCAGTG
AACAGCATCACCTTCTCCAGCACTGACCCTCAAGACCGGAGATGGACCAACCCAGACGGG
ACCACCTCCAAGATCTTTGGTTTCGTGGCCAAGAAGCCGGGAAGCCCCTGGGAGAATGTG
TGTCACCTCTTTGCAGAGCTTGACCCAGATCAGCCTGCTGGCGCCATTGTCACCTTCATC
ACCAAAGTTCTACTGGGCCAGAGAAAATGA
Protein Properties
Number of Residues 1409
Molecular Weight 152579.0
Theoretical pI 8.42
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Tensin-like C1 domain-containing phosphatase
MKSSGPVERLLRALGRRDSSRAASRPRKAEPHSFREKVFRKKPPVCAVCKVTIDGTGVSC
RVCKVATHRKCEAKVTSACQALPPVELRRNTAPVRRIEHLGSTKSLNHSKQRSTLPRSFS
LDPLMERRWDLDLTYVTERILAAAFPARPDEQRHRGHLRELAHVLQSKHRDKYLLFNLSE
KRHDLTRLNPKVQDFGWPELHAPPLDKLCSICKAMETWLSADPQHVVVLYCKGNKGKLGV
IVSAYMHYSKISAGADQALATLTMRKFCEDKVATELQPSQRRYISYFSGLLSGSIRMNSS
PLFLHYVLIPMLPAFEPGTGFQPFLKIYQSMQLVYTSGVYHIAGPGPQQLCISLEPALLL
KGDVMVTCYHKGGRGTDRTLVFRVQFHTCTIHGPQLTFPKDQLDEAWTDERFPFQASVEF
VFSSSPEKIKGSTPRNDPSVSVDYNTTEPAVRWDSYENFNQHHEDSVDGSLTHTRGPLDG
SPYAQVQRPPRQTPPAPSPEPPPPPMLSVSSDSGHSSTLTTEPAAESPGRPPPTAAERQE
LDRLLGGCGVASGGRGAGRETAILDDEEQPTVGGGPHLGVYPGHRPGLSRHCSCRQGYRE
PCGVPNGGYYRPEGTLERRRLAYGGYEGSPQGYAEASMEKRRLCRSLSEGLYPYPPEMGK
PATGDFGYRAPGYREVVILEDPGLPALYPCPACEEKLALPTAALYGLRLEREAGEGWASE
AGKPLLHPVRPGHPLPLLLPACGHHHAPMPDYSCLKPPKAGEEGHEGCSYTMCPEGRYGH
PGYPALVTYSYGGAVPSYCPAYGRVPHSCGSPGEGRGYPSPGAHSPRAGSISPGSPPYPQ
SRKLSYEIPTEEGGDRYPLPGHLASAGPLASAESLEPVSWREGPSGHSTLPRSPRDAPCS
ASSELSGPSTPLHTSSPVQGKESTRRQDTRSPTSAPTQRLSPGEALPPVSQAGTGKAPEL
PSGSGPEPLAPSPVSPTFPPSSPSDWPQERSPGGHSDGASPRSPVPTTLPGLRHAPWQGP
RGPPDSPDGSPLTPVPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQPPLPEKRHLP
GPGQQPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSNVKFVQDTSKFW
YKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVR
HFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEETPEAPVP
TNMSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSA
QGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENV
CHLFAELDPDQPAGAIVTFITKVLLGQRK
GenBank ID Protein 38787957
UniProtKB/Swiss-Prot ID Q63HR2
UniProtKB/Swiss-Prot Entry Name TENC1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_170754.2
GeneCard ID TENC1
GenAtlas ID TENC1
HGNC ID HGNC:19737
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  5. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  6. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  7. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  8. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  9. Kikuno R, Nagase T, Ishikawa K, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Jun 30;6(3):197-205. [PubMed:10470851 ]
  10. Hafizi S, Alindri F, Karlsson R, Dahlback B: Interaction of Axl receptor tyrosine kinase with C1-TEN, a novel C1 domain-containing protein with homology to tensin. Biochem Biophys Res Commun. 2002 Dec 20;299(5):793-800. [PubMed:12470648 ]
  11. Chen H, Duncan IC, Bozorgchami H, Lo SH: Tensin1 and a previously undocumented family member, tensin2, positively regulate cell migration. Proc Natl Acad Sci U S A. 2002 Jan 22;99(2):733-8. Epub 2002 Jan 15. [PubMed:11792844 ]
  12. Hafizi S, Ibraimi F, Dahlback B: C1-TEN is a negative regulator of the Akt/PKB signal transduction pathway and inhibits cell survival, proliferation, and migration. FASEB J. 2005 Jun;19(8):971-3. Epub 2005 Apr 7. [PubMed:15817639 ]