You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10944
Secondary Accession Numbers
  • 17257
Name Neutral cholesterol ester hydrolase 1
Synonyms
  1. Arylacetamide deacetylase-like 1
  2. NCEH
Gene Name NCEH1
Protein Type Enzyme
Biological Properties
General Function Involved in hydrolase activity
Specific Function Hydrolyzes 2-acetyl monoalkylglycerol ether, the penultimate precursor of the pathway for de novo synthesis of platelet-activating factor. May be responsible for cholesterol ester hydrolysis in macrophages, thereby contributing to the development of atherosclerosis. Also involved in organ detoxification by hydrolyzing exogenous organophosphorus compounds. May contribute to cancer pathogenesis by promoting tumor cell migration
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
carboxylesterase activity
Process
metabolic process
Cellular Location
  1. Membrane
  2. Microsome
  3. Single-pass type II membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:3
Locus 3q26.31
SNPs NCEH1
Gene Sequence
>1227 bp
ATGAGGTCGTCCTGTGTCCTGCTCACCGCCCTGGTGGCGCTGGCCGCCTATTACGTCTAC
ATCCCGCTGCCTGGCTCCGTGTCCGACCCCTGGAAGCTGATGCTGCTGGACGCCACTTTC
CGGGGTGCACAGCAAGTGAGTAACCTGATCCACTACCTGGGACTGAGCCATCACCTGCTG
GCACTGAATTTTATCATTGTTTCTTTTGGCAAAAAAAGCGCGTGGTCTTCTGCCCAAGTG
AAGGTGACCGACACAGACTTTGATGGTGTGGAAGTCAGAGTGTTTGAAGGCCCTCCGAAG
CCCGAAGAGCCACTGAAACGCAGCGTCGTTTATATCCACGGAGGAGGCTGGGCCTTGGCA
AGTGCAAAAATCAGGTATTATGATGAGCTGTGTACAGCAATGGCTGAGGAATTGAATGCT
GTCATTGTTTCCATTGAATACAGGCTAGTTCCAAAGGTTTATTTTCCTGAGCAAATTCAT
GATGTTGTACGGGCCACAAAGTATTTCCTGAAGCCAGAAGTCTTACAGAAGTATATGGTT
GATCCAGGCAGAATTTGCATTTCTGGTGACAGTGCTGGTGGAAATCTGGCTGCTGCCCTT
GGACAACAGTTTACTCAAGATGCCAGCCTAAAAAATAAGCTCAAACTACAAGCTTTAATT
TATCCAGTTCTTCAAGCTTTAGATTTTAACACACCATCTTATCAGCAAAATGTGAACACC
CCAATCCTGCCCCGCTATGTCATGGTGAAGTATTGGGTGGACTACTTCAAAGGCAACTAT
GACTTTGTGCAGGCAATGATCGTTAACAATCACACTTCACTTGATGTGGAAGAGGCTGCT
GCTGTCAGGGCCCGTCTAAACTGGACATCCCTCTTGCCTGCATCCTTCACAAAGAACTAC
AAGCCTGTTGTACAGACCACAGGCAATGCCAGGATTGTCCAGGAGCTTCCTCAGTTGCTG
GATGCCCGCTCCGCCCCACTCATTGCAGACCAGGCAGTGCTGCAGCTCCTCCCAAAGACC
TACATTCTGACGTGTGAGCATGATGTCCTCAGAGACGATGGCATCATGTATGCCAAGCGT
TTGGAGAGTGCCGGTGTGGAGGTGACCCTGGATCACTTTGAGGATGGCTTTCACGGATGT
ATGATTTTCACTAGCTGGCCCACCAACTTCTCAGTGGGAATCCGGACTAGGAATAGTTAC
ATCAAGTGGCTAGATCAAAACCTGTAA
Protein Properties
Number of Residues 408
Molecular Weight 45807.4
Theoretical pI 7.26
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 5-25
Protein Sequence
>Neutral cholesterol ester hydrolase 1
MRSSCVLLTALVALAAYYVYIPLPGSVSDPWKLMLLDATFRGAQQVSNLIHYLGLSHHLL
ALNFIIVSFGKKSAWSSAQVKVTDTDFDGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALA
SAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEVLQKYMV
DPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALIYPVLQALDFNTPSYQQNVNT
PILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNY
KPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVLRDDGIMYAKR
LESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL
GenBank ID Protein 221040514
UniProtKB/Swiss-Prot ID Q6PIU2
UniProtKB/Swiss-Prot Entry Name NCEH1_HUMAN
PDB IDs Not Available
GenBank Gene ID AK294811
GeneCard ID NCEH1
GenAtlas ID NCEH1
HGNC ID HGNC:29260
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Feb 28;7(1):65-73. [PubMed:10718198 ]
  5. Jessani N, Liu Y, Humphrey M, Cravatt BF: Enzyme activity profiles of the secreted and membrane proteome that depict cancer cell invasiveness. Proc Natl Acad Sci U S A. 2002 Aug 6;99(16):10335-40. Epub 2002 Jul 29. [PubMed:12149457 ]
  6. Chiang KP, Niessen S, Saghatelian A, Cravatt BF: An enzyme that regulates ether lipid signaling pathways in cancer annotated by multidimensional profiling. Chem Biol. 2006 Oct;13(10):1041-50. [PubMed:17052608 ]
  7. Okazaki H, Igarashi M, Nishi M, Sekiya M, Tajima M, Takase S, Takanashi M, Ohta K, Tamura Y, Okazaki S, Yahagi N, Ohashi K, Amemiya-Kudo M, Nakagawa Y, Nagai R, Kadowaki T, Osuga J, Ishibashi S: Identification of neutral cholesterol ester hydrolase, a key enzyme removing cholesterol from macrophages. J Biol Chem. 2008 Nov 28;283(48):33357-64. doi: 10.1074/jbc.M802686200. Epub 2008 Sep 9. [PubMed:18782767 ]