You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10949
Secondary Accession Numbers
  • 17262
Name GEM-interacting protein
Synonyms
  1. GMIP
Gene Name GMIP
Protein Type Unknown
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function Stimulates, in vitro and in vivo, the GTPase activity of RhoA
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signaling pathway
signaling
signaling pathway
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.11
SNPs GMIP
Gene Sequence
>2913 bp
ATGGACGCAGCAGAGCCGGGACTCCCCCCAGGTCCTGAGGGCAGGAAGAGGTACAGTGAC
ATCTTCCGGAGCCTGGACAACCTCGAAATCTCACTGGGGAACGTGACCCTTGAGATGCTG
GCTGGAGACCCTCTACTCTCAGAAGACCCAGAACCTGACAAGACCCCTACAGCCACTGTT
ACCAACGAAGCCAGCTGTTGGAGCGGCCCCTCCCCAGAGGGTCCTGTACCCCTCACAGGG
GAGGAACTGGACTTGCGGCTCATTCGGACAAAGGGGGGTGTGGACGCAGCCCTGGAATAT
GCCAAGACCTGGAGCCGCTATGCCAAGGAACTGCTTGCCTGGACTGAAAAGAGAGCCAGC
TATGAGCTGGAGTTTGCTAAGAGCACCATGAAGATCGCTGAAGCTGGCAAGGTGTCCATT
CAACAGCAGAGCCACATGCCTCTGCAGTACATCTACACCCTGTTTCTGGAGCACGATCTC
AGCCTGGGAACCCTGGCCATGGAGACAGTGGCCCAGCAGAAAAGAGACTACTACCAGCCC
CTCGCCGCCAAACGGACTGAGATTGAGAAGTGGCGGAAGGAGTTCAAGGAGCAGTGGATG
AAGGAGCAGAAGCGGATGAATGAGGCGGTGCAGGCACTGCGGCGCGCCCAGCTGCAGTAT
GTGCAACGCAGCGAGGACCTGCGGGCACGCTCCCAGGGGTCCCCTGAGGACTCGGCCCCC
CAGGCCTCGCCGGGACCTAGCAAGCAGCAGGAGCGGCGGCGGCGCTCGCGAGAGGAGGCC
CAGGCCAAGGCGCAGGAGGCCGAGGCGCTGTACCAGGCCTGTGTCCGCGAGGCCAACGCG
CGGCAGCAGGACCTGGAGATCGCCAAGCAGCGAATCGTGTCGCACGTGCGCAAGCTGGTG
TTTCAGGGGGATGAAGTGCTGAGGCGGGTGACGCTGAGTCTCTTCGGGCTGCGGGGGGCG
CAGGCAGAGCGTGGCCCCCGCGCCTTCGCCGCCCTGGCCGAGTGCTGTGCGCCCTTTGAG
CCGGGCCAGCGCTACCAGGAGTTTGTACGGGCGCTGCGGCCCGAGGCCCCGCCGCCCCCG
CCGCCCGCCTTCTCCTTCCAGGAGTTCCTTCCCTCCTTGAACAGCTCCCCTCTGGACATC
AGAAAGAAGCTCTCTGGGCCTCTTCCTCCAAGGCTGGATGAGAATTCAGCTGAGCCAGGC
CCTTGGGAGGATCCGGGCACAGGCTGGCGCTGGCAAGGGACTCCAGGCCCCACTCCGGGC
AGCGATGTGGACAGCGTGGGTGGCGGCAGCGAGTCTCGGTCCCTGGACTCACCCACTTCC
AGCCCAGGCGCTGGCACGAGGCAGCTGGTGAAGGCTTCGTCCACAGGCACTGAGTCCTCA
GATGACTTTGAGGAGCGAGACCCTGACCTGGGAGACGGGCTGGAGAATGGGCTGGGCAGC
CCCTTCGGGAAGTGGACACTGTCCAGCGCGGCTCAGACCCACCAGCTGCGGCGACTGCGG
GGCCCAGCCAAGTGCCGCGAGTGCGAAGCCTTCATGGTCAGCGGGACGGAGTGTGAGGAG
TGCTTTCTGACCTGCCACAAGCGCTGCCTGGAGACTCTCCTGATCCTCTGTGGACACAGG
CGGCTCCCAGCCCGGACACCCCTTTTTGGGGTTGACTTCCTGCAGCTACCCAGGGACTTC
CCGGAGGAGGTACCCTTTGTGGTCACGAAGTGCACGGCTGAGATAGAACACCGTGCCCTG
GATGTGCAGGGCATTTACCGGGTCAGCGGGTCCCGGGTCCGTGTGGAGCGGCTGTGCCAG
GCTTTCGAGAATGGCCGAGCGTTGGTGGAGCTGTCGGGGAACTCGCCTCATGACGTCTCG
AGTGTCCTCAAGCGATTTCTTCAGGAGCTCACCGAGCCCGTGATCCCCTTCCACCTCTAC
GACGCCTTCATCTCTCTGGCTAAGACCTTGCATGCAGACCCTGGGGACGACCCTGGGACC
CCCAGCCCCAGCCCTGATGTTATCCGCTCGCTGAAGACCCTCTTGGTACAGCTGCCTGAC
TCTAACTACAACACCCTGCGGCACCTGGTGGCCCATCTGTTCAGGGTGGCTGCACGATTT
ATGGAAAACAAGATGTCTGCCAACAACCTGGGCATTGTGTTTGGGCCGACACTGCTGCGG
CCGCCGGACGGCCCGCGGGCAGCCAGCGCCATCCCTGTCACCTGCCTGCTGGACTCTGGG
CATCAGGCCCAGCTTGTGGAGTTCCTCATCGTGCACTACGAGCAGATCTTTGGGATGGAT
GAGCTCCCCCAGGCCACTGAGCCCCCGCCCCAAGACTTCAGCCCAGCCCCTGGGCCCCTC
ACAACCAGCTCCCAACCGCCACCCCCGCACCTTGACCCAGACTCCCAGCCCCCAGTCCTA
GCCTCAGACCCCGGCCCAGACCCCCAGCACCACAGTACCCTGGAGCAGCATCCCACGGCC
ACACCTACCGAGATTCCAACTCCACAGAGTGACCAGAGAGAGGACGTGGCTGAAGACACC
AAAGATGGGGGAGGGGAAGTGTCCAGCCAAGGCCCAGAGGACTCACTCCTGGGGACACAG
TCTCGTGGCCACTTCAGCCGCCAGCCATGTAAGTATCCCCGGGGCGGTGTGAGGCCTGTA
ACCCACCAGCTGTCCAGTCTGGCCCTGGTGGCTTCCAAGCTGTGCGAGGAGACCCCCATC
ACATCAGTGCCCAGAGGGAGTTTGCGGGGGCGGGGGCCCAGCCCTGCAGCTGCCTCCCCT
GAGGGCAGCCCCCTGCGCCGCACCCCGCTGCCCAAGCATTTTGAGATTACCCAGGAGACA
GCCCGGCTACTCTCGAAATTGGACAGCGAGGCTGTGCCCAGGGCCACCTGCTGCCCGGAC
GTCCAGCCTGAGGAAGCCGAGGACCATCTCTGA
Protein Properties
Number of Residues 970
Molecular Weight 106681.8
Theoretical pI 5.46
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>GEM-interacting protein
MDAAEPGLPPGPEGRKRYSDIFRSLDNLEISLGNVTLEMLAGDPLLSEDPEPDKTPTATV
TNEASCWSGPSPEGPVPLTGEELDLRLIRTKGGVDAALEYAKTWSRYAKELLAWTEKRAS
YELEFAKSTMKIAEAGKVSIQQQSHMPLQYIYTLFLEHDLSLGTLAMETVAQQKRDYYQP
LAAKRTEIEKWRKEFKEQWMKEQKRMNEAVQALRRAQLQYVQRSEDLRARSQGSPEDSAP
QASPGPSKQQERRRRSREEAQAKAQEAEALYQACVREANARQQDLEIAKQRIVSHVRKLV
FQGDEVLRRVTLSLFGLRGAQAERGPRAFAALAECCAPFEPGQRYQEFVRALRPEAPPPP
PPAFSFQEFLPSLNSSPLDIRKKLSGPLPPRLDENSAEPGPWEDPGTGWRWQGTPGPTPG
SDVDSVGGGSESRSLDSPTSSPGAGTRQLVKASSTGTESSDDFEERDPDLGDGLENGLGS
PFGKWTLSSAAQTHQLRRLRGPAKCRECEAFMVSGTECEECFLTCHKRCLETLLILCGHR
RLPARTPLFGVDFLQLPRDFPEEVPFVVTKCTAEIEHRALDVQGIYRVSGSRVRVERLCQ
AFENGRALVELSGNSPHDVSSVLKRFLQELTEPVIPFHLYDAFISLAKTLHADPGDDPGT
PSPSPEVIRSLKTLLVQLPDSNYNTLRHLVAHLFRVAARFMENKMSANNLGIVFGPTLLR
PPDGPRAASAIPVTCLLDSGHQAQLVEFLIVHYEQIFGMDELPQATEPPPQDSSPAPGPL
TTSSQPPPPHLDPDSQPPVLASDPGPDPQHHSTLEQHPTATPTEIPTPQSDQREDVAEDT
KDGGGEVSSQGPEDSLLGTQSRGHFSRQPVKYPRGGVRPVTHQLSSLALVASKLCEETPI
TSVPRGSLRGRGPSPAAASPEGSPLRRTPLPKHFEITQETARLLSKLDSEAVPRATCCPD
VQPEEAEDHL
GenBank ID Protein 7380947
UniProtKB/Swiss-Prot ID Q9P107
UniProtKB/Swiss-Prot Entry Name GMIP_HUMAN
PDB IDs Not Available
GenBank Gene ID AF132541
GeneCard ID GMIP
GenAtlas ID GMIP
HGNC ID HGNC:24852
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  5. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Aresta S, de Tand-Heim MF, Beranger F, de Gunzburg J: A novel Rho GTPase-activating-protein interacts with Gem, a member of the Ras superfamily of GTPases. Biochem J. 2002 Oct 1;367(Pt 1):57-65. [PubMed:12093360 ]