You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10959
Secondary Accession Numbers
  • 17273
Name Beta-chimaerin
Synonyms
  1. Beta-chimerin
  2. Rho GTPase-activating protein 3
Gene Name CHN2
Protein Type Unknown
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function GTPase-activating protein for p21-rac. Insufficient expression of beta-2 chimaerin is expected to lead to higher Rac activity and could therefore play a role in the progression from low-grade to high-grade tumors
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
binding
protein binding
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signaling pathway
signaling
signaling pathway
Cellular Location
  1. Membrane
  2. Peripheral membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:7
Locus 7p15.3
SNPs CHN2
Gene Sequence
>1407 bp
ATGGCAGCGTCCAGCAACTCCAGCCTGTCCGGCTCGTCGGTGTCCTCCGATGCTGAAGAA
TACCAGCCTCCTATATGGAAATCATACTTATATCAGTTACAGCAAGAGGCACCTCGTCCC
AAGAGAATCATTTGTCCTCGGGAGGTGGAAAACAGACCAAAATATTATGGAAGAGAGTTT
CATGGGATCATCTCTCGGGAGCAGGCGGATGAGCTTCTTGGAGGCGTGGAGGGTGCCTAC
ATCCTTAGAGAAAGCCAGCGGCAACCAGGATGCTACACGCTGGCTCTCAGGTTTGGAAAC
CAGACCTTAAACTACAGGCTCTTCCACGACGGGAAACACTTTGTGGGTGAGAAGAGGTTT
GAGTCGATTCATGATCTGGTGACAGATGGCTTGATAACACTGTACATAGAAACAAAAGCT
GCCGAGTACATTTCAAAAATGACAACTAACCCCATCTATGAACACATTGGATATGCCACC
CTACTCAGAGAAAAAGTATCCAGAAGGCTGAGCAGGTCTAAAAATGAACCAAGAAAAACA
AACGTCACACATGAAGAACACACAGCGGTGGAAAAGATCTCCTCCCTGGTTCGAAGGGCT
GCCCTCACACACAACGACAACCACTTCAATTATGAGAAGACACACAACTTTAAGGTCCAC
ACGTTCCGAGGCCCACACTGGTGTGAATATTGTGCCAATTTCATGTGGGGGCTCATCGCC
CAAGGGGTCCGGTGCTCAGACTGTGGATTGAACGTACACAAACAGTGTTCCAAGCACGTT
CCCAATGACTGCCAACCTGATCTCAAGAGGATCAAGAAAGTGTACTGTTGTGACCTCACA
ACACTTGTGAAGGCTCACAACACTCAGAGACCCATGGTGGTAGACATATGCATTCGGGAA
ATTGAAGCAAGAGGATTAAAATCGGAAGGCCTTTACAGAGTCTCTGGGTTCACTGAACAC
ATTGAAGATGTCAAAATGGCATTTGACAGAGATGGTGAAAAGGCCGATATATCTGCCAAT
GTCTATCCAGACATAAACATCATCACTGGAGCCCTTAAACTGTATTTCAGAGACTTACCC
ATCCCTGTCATCACATATGATACCTATTCCAAATTTATAGATGCAGCAAAAATCTCCAAT
GCAGATGAGAGGCTGGAAGCCGTCCATGAAGTGCTGATGCTGCTGCCTCCTGCCCACTAT
GAAACCCTCCGGTACCTAATGATCCACCTCAAAAAGGTTACTATGAATGAAAAAGACAAT
TTCATGAATGCAGAAAATCTGGGGATCGTGTTTGGGCCCACTCTGATGAGGCCCCCTGAG
GACAGCACCCTGACCACCCTGCATGATATGCGGTACCAAAAGCTGATTGTGCAGATTTTA
ATAGAAAACGAAGACGTTTTATTCTAA
Protein Properties
Number of Residues 468
Molecular Weight 53923.1
Theoretical pI 7.45
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Beta-chimaerin
MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREF
HGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRF
ESIHDLVTDGLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKT
NVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIA
QGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIRE
IEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGALKLYFRDLP
IPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDN
FMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF
GenBank ID Protein 4757980
UniProtKB/Swiss-Prot ID P52757
UniProtKB/Swiss-Prot Entry Name CHIO_HUMAN
PDB IDs
GenBank Gene ID NM_004067.2
GeneCard ID CHN2
GenAtlas ID CHN2
HGNC ID HGNC:1944
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  3. Leung T, How BE, Manser E, Lim L: Cerebellar beta 2-chimaerin, a GTPase-activating protein for p21 ras-related rac is specifically expressed in granule cells and has a unique N-terminal SH2 domain. J Biol Chem. 1994 Apr 29;269(17):12888-92. [PubMed:8175705 ]
  4. Yuan S, Miller DW, Barnett GH, Hahn JF, Williams BR: Identification and characterization of human beta 2-chimaerin: association with malignant transformation in astrocytoma. Cancer Res. 1995 Aug 1;55(15):3456-61. [PubMed:7614486 ]