You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10963
Secondary Accession Numbers
  • 17277
Name Unc-13 homolog B (C. elegans)
Synonyms Not Available
Gene Name UNC13B
Protein Type Unknown
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:9
Locus 9p13.3
SNPs UNC13B
Gene Sequence
>4869 bp
ATGTCACTGCTCTGCGTGCGCGTTAAAAGGGCCAAATTCCAGGGTTCACCAGATAAATTT
AACACATATGTGACCCTGAAAGTACAGAATGTGAAGAGCACAACTGTAGCAGTTCGTGGT
GATCAGCCTTCCTGGGAACAGGATTTCATGTTTGAGATTAGTCGCCTGGACCTGGGTCTA
AGTGTGGAGGTATGGAACAAAGGACTGATCTGGGACACCATGGTGGGGACTGTGTGGATT
GCGCTGAAGACTATTCGTCAGTCGGATGAGGAAGGGCCTGGGGAATGGTCCACATTAGAG
GCAGAGACGTTAATGAAAGACGATGAGATCTGTGGAACTAGAAACCCAACTCCTCATAAA
ATTTTGCTTGATACAAGATTTGAGTTGCCTTTTGATATCCCAGAGGAGGAAGCCAGATAT
TGGACCTACAAATGGGAGCAAATCAATGCCTTGGGAGCTGACAATGAGTATTCTAGTCAA
GAAGAAAGCCAGAGGAAGCCATTGCCCACTGCTGCCGCCCAGTGTTGTCACTGGACCTAT
TTGGGCTGGGGAGAACAACAGACTTTTGAAGACCCTGATAGTGCCGTCGATGACCGAGAT
AGTGACTATCGCAGTGAGACCAGCAACAGCTTCCCACCTCCTTACCATACAGCTTCCCAG
CCCAACGCTTCTGTGCACCAGTTCCCTGTGCCGGTGCGATCGCCACAGCAGCTGCTACTT
CAAGGCAGTTCCCGGGACTCTTGTAATGACTCTATGCAAAGTTATGACCTTGATTATCCA
GAGCGGCGGGCTATCAGCCCCACCAGCAGCAGTAGGTATGGCTCCTCCTGTAATGTGAGT
CAAGGAAGCTCTCAGCTAAGTGAACTAGACCAGTATCACGAACAAGATGACGACCATCGG
GAGACGGACTCGATTCATTCTTGCCACAGCTCTCACAGCCTGTCCAGAGATGGCCAAGCA
GGTTTTGGAGAACAAGAGAAACCCTTGGAGGTGACAGGTCAAGCAGAGAAGGAGGCAGCA
TGTGAACCCAAGGAGATGAAAGAAGATGCCACAACCCACCCTCCCCCAGATCTGGTGCTG
CAAAAAGACCACTTCCTAGGTCCCCAGGAGAGTTTTCCTGAGGAGAATGCATCTTCACCA
TTTACCCAAGCCAGAGCACATTGGATCCGAGCAGTTACCAAGGTTCGACTCCAGCTGCAG
GAGATTCCAGATGATGGTGACCCCTCTCTGCCTCAGTGGCTCCCGGAAGGGCCAGCCGGA
GGGCTCTATGGCATTGACAGCATGCCAGATTTACGCAGAAAGAAGCCACTGCCACTTGTC
AGTGATCTGTCACTGGTCCAGTCTCGGAAGGCAGGAATCACTTCTGCAATGGCTACACGC
ACTTCTCTTAAGGACGAAGAGCTGAAATCCCACGTGTATAAGAAAACCCTGCAGGCCTTA
ATCTACCCCATTTCGTGCACCACTCCTCATAACTTTGAGGTCTGGACGGCCACTACCCCA
ACCTACTGCTATGAGTGTGAAGGCCTGCTCTGGGGCATTGCCCGGCAGGGCATGCGCTGC
AGCGAATGTGGAGTCAAGTGCCATGAGAAGTGCCAGGATCTGCTCAATGCTGACTGCCTG
CAGCGGGCTGCAGAAAAGAGCTGTAAACATGGAGCTGAGGACCGGACCCAGAACATTATC
ATGGCCATGAAGGACCGCATGAAGATCCGAGAGCGAAATAAGCCAGAGATCTTTGAAGTT
ATCCGGGACGTCTTCACAGTGAACAAAGCTGCCCATGTGCAGCAGATGAAAACAGTGAAG
CAGAGTGTACTGGATGGCACCTCCAAATGGTCAGCCAAGATCACCATTACTGTGGTGTGT
GCCCAGGGCCTACAAGCCAAGGACAAAACAGGATCCAGTGACCCTTACGTGACTGTGCAA
GTCAGCAAAACTAAGAAGCGTACCAAGACCATTTTTGGAAACTTGAATCCTGTTTGGGAG
GAGAAGTTCCATTTTGAGTGCCACAACTCCTCTGACCGCATTAAGGTGCGTGTATGGGAT
GAGGATGATGACATCAAGTCAAGAGTAAAGCAACGCCTAAAGCGAGAGTCTGATGATTTC
CTTGGCCAAACCATCATTGAGGTTCGGACCCTAAGTGGCGAGATGGACGTCTGGTACAAC
TTGGAGAAGAGGACAGACAAATCAGCCGTCTCAGGGGCTATCCGACTACAAATCAGTGTG
GAGATCAAGGGGGAGGAGAAAGTAGCCCCATACCACGTGCAGTATACATGTCTCCATGAG
AATCTTTTCCATTACCTCACAGACATTCAGGGCAGTGGAGGAGTCCGCATCCCTGAAGCT
CGAGGAGACGATGCCTGGAAGGTGTACTTTGATGAGACAGCCCAAGAAATTGTGGATGAA
TTTGCCATGCGTTATGGCATTGAGTCCATATATCAGGCCATGACGCACTTTGCATGTTTA
TCATCCAAGTACATGTGTCCTGGTGTGCCAGCAGTGATGAGCACCTTACTGGCCAACATC
AACGCCTACTATGCCCACACAACTGCCTCTACCAATGTCTCTGCATCTGATCGCTTTGCA
GCCTCCAACTTTGGGAAAGAGAGATTTGTAAAACTGCTGGACCAGCTACACAACTCACTG
AGGATCGACCTCTCTACATACAGGAATAATTTCCCTGCTGGGAGTCCTGAACGGCTTCAG
GACTTAAAATCCACAGTGGATTTGCTGACCAGCATTACTTTCTTCAGAATGAAGGTACAA
GAACTGCAAAGCCCTCCAAGAGCCAGCCAGGTGGTAAAGGATTGTGTGAAGGCCTGTTTG
AACTCCACATATGAATATATCTTCAACAACTGCCACGACTTATACAGCCGCCAGTACCAG
CTGAAGCAGGAGCTACCTCCAGAGGAACAAGGGCCCAGCATTCGGAACCTGGATTTCTGG
CCCAAGCTCATCACACTCATCGTGTCAATCATAGAGGAAGATAAGAATTCCTACACACCT
GTTCTGAACCAGTTTCCTCAGGAGTTGAATGTGGGAAAAGTCAGCGCAGAAGTGATGTGG
CATTTGTTTGCCCAAGACATGAAATATGCATTGGAGGAGCATGAGAAAGACCACCTGTGT
AAAAGTGCTGACTACATGAACCTGCACTTCAAGGTGAAGTGGCTCCACAATGAATACGTG
CGGGATCTGCCTGTCCTCCAGGGGCAGGTGCCTGAGTACCCAGCGTGGTTTGAGCAGTTC
GTGCTACAATGGCTGGATGAGAATGAGGATGTATCCCTGGAATTCCTGCGTGGGGCCCTG
GAACGAGATAAGAAGGATGGATTCCAGCAGACATCAGAGCATGCACTCTTTTCCTGCTCT
GTGGTGGATGTCTTCACACAACTCAATCAGAGCTTTGAGATCATCCGGAAGCTGGAATGC
CCAGACCCCAGCATCCTTGCCCACTACATGAGGAGGTTTGCTAAGACCATCGGGAAGGTG
CTGATGCAGTATGCAGACATCTTGTCAAAGGACTTCCCAGCCTATTGCACAAAGGAGAAA
CTGCCCTGCATCCTGATGAACAACGTGCAGCAACTGAGGGTCCAGCTGGAGAAAATGTTT
GAGGCCATGGGAGGCAAGGAGCTGGACCTTGAAGCTGCAGACAGTCTGAAGGAGCTGCAG
GTGAAACTGAATACGGTTCTGGATGAGCTCAGCATGGTGTTTGGAAACAGTTTCCAGGTA
CGGATTGATGAGTGTGTTCGACAAATGGCCGACATCCTGGGCCAGGTTCGGGGCACAGGG
AATGCATCTCCAGACGCCAGGGCCTCAGCGGCTCAGGATGCAGATAGCGTACTCCGGCCT
CTCATGGACTTCCTGGATGGCAACCTCACCCTCTTTGCCACTGTGTGTGAGAAGACGGTT
CTGAAGCGTGTACTGAAGGAGCTCTGGCGCGTGGTGATGAACACAATGGAGAGGATGATT
GTTCTGCCCCCACTCACTGACCAGACGGGCACCCAGCTGATCTTCACTGCTGCCAAGGAG
CTGAGCCATCTTTCCAAACTCAAGGATCACATGGTACGAGAGGAAACACGGAATCTCACT
CCAAAGCAGTGTGCAGTCCTTGACCTCGCCCTGGACACCATCAAGCAATACTTCCATGCA
GGAGGCAATGGGCTGAAGAAAACCTTCCTGGAGAAGAGCCCAGATCTGCAGTCTCTACGC
TATGCCCTGTCTCTGTACACACAGACTACTGACACTCTCATCAAGACCTTTGTGCGCTCG
CAGACCACCCAAGTGCATGATGGGAAAGGTATTAGATTTACTGCTAATGAGGACATTCGT
CCGGAAAAGGGGTCTGGTGTGGACGATCCTGTGGGAGAAGTCTCTATTCAGGTGGACTTG
TTTACACACCCTGGTACTGGGGAGCACAAGGTCACAGTGAAAGTGGTGGCTGCCAATGAC
CTCAAGTGGCAGACAGCGGGTATGTTCCGGCCTTTCGTGGAGGTGACTATGGTTGGCCCA
CACCAAAGTGATAAGAAGAGGAAGTTCACAACCAAATCCAAAAGCAACAACTGGGCCCCC
AAGTACAATGAGACATTCCACTTCCTCCTGGGAAATGAGGAGGGGCCCGAGTCCTATGAG
TTGCAGATATGCGTGAAGGATTACTGCTTTGCCCGGGAAGATCGCGTGCTAGGGCTGGCT
GTGATGCCTCTGAGGGATGTCACAGCCAAGGGCAGCTGTGCCTGCTGGTGCCCCTTGGGC
CGGAAGATCCATATGGATGAGACAGGCCTGACCATTCTCCGGATTTTATCTCAGAGGAGC
AATGACGAGGTGGCCCGAGAATTTGTGAAACTCAAATCAGAGTCTCGTTCCACGGAGGAG
GGGAGCTGA
Protein Properties
Number of Residues 1622
Molecular Weight 184345.3
Theoretical pI 5.88
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Unc-13 homolog B (C. elegans)
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEICGTRNPTPHK
ILLDTRFELPFDIPEEEARYWTYKWEQINALGADNEYSSQEESQRKPLPTAAAQCCHWTY
LGWGEQQTFEDPDSAVDDRDSDYRSETSNSFPPPYHTASQPNASVHQFPVPVRSPQQLLL
QGSSRDSCNDSMQSYDLDYPERRAISPTSSSRYGSSCNVSQGSSQLSELDQYHEQDDDHR
ETDSIHSCHSSHSLSRDGQAGFGEQEKPLEVTGQAEKEAACEPKEMKEDATTHPPPDLVL
QKDHFLGPQESFPEENASSPFTQARAHWIRAVTKVRLQLQEIPDDGDPSLPQWLPEGPAG
GLYGIDSMPDLRRKKPLPLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTLQAL
IYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCL
QRAAEKSCKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVNKAAHVQQMKTVK
QSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVSKTKKRTKTIFGNLNPVWE
EKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYN
LEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVRIPEA
RGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANI
NAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQ
DLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSRQYQ
LKQELPPEEQGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMW
HLFAQDMKYALEEHEKDHLCKSADYMNLHFKVKWLHNEYVRDLPVLQGQVPEYPAWFEQF
VLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLEC
PDPSILAHYMRRFAKTIGKVLMQYADILSKDFPAYCTKEKLPCILMNNVQQLRVQLEKMF
EAMGGKELDLEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGTG
NASPDARASAAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMI
VLPPLTDQTGTQLIFTAAKELSHLSKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHA
GGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTTQVHDGKGIRFTANEDIR
PEKGSGVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGP
HQSDKKRKFTTKSKSNNWAPKYNETFHFLLGNEEGPESYELQICVKDYCFAREDRVLGLA
VMPLRDVTAKGSCACWCPLGRKIHMDETGLTILRILSQRSNDEVAREFVKLKSESRSTEE
GS
GenBank ID Protein 55661547
UniProtKB/Swiss-Prot ID B1AM27
UniProtKB/Swiss-Prot Entry Name B1AM27_HUMAN
PDB IDs
GenBank Gene ID AL160274
GeneCard ID UNC13B
GenAtlas ID UNC13B
HGNC ID HGNC:12566
References
General References Not Available