You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10968
Secondary Accession Numbers
  • 17282
Name PDZ domain-containing protein 8
Synonyms
  1. Sarcoma antigen NY-SAR-84/NY-SAR-104
Gene Name PDZD8
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 10q26.12
SNPs PDZD8
Gene Sequence
>3465 bp
ATGGGGCTGCTGCTCATGATCCTGGCGTCGGCCGTGCTGGGTTCCTTCCTCACGCTCCTC
GCCCAGTTCTTCCTGCTGTACCGCAGACAGCCCGAGCCGCCGGCGGACGAGGCCGCCCGC
GCGGGCGAGGGCTTCCGCTACATCAAGCCAGTGCCGGGCCTGCTCCTAAGGGAGTACCTT
TATGGCGGCGGCCGGGATGAGGAGCCCTCCGGAGCGGCCCCTGAGGGCGGCGCGACCCCC
ACCGCGGCCCCCGAGACCCCCGCCCCGCCGACGCGGGAGACTTGCTACTTCCTCAACGCC
ACCATCCTATTCCTGTTCCGGGAGTTGCGGGACACCGCGCTGACCCGCCGCTGGGTCACC
AAGAAGATCAAGGTGGAGTTCGAGGAGCTGCTGCAGACCAAGACGGCCGGGCGCCTGCTG
GAGGGGCTGAGCCTGCGGGACGTGTTCCTGGGCGAGACGGTGCCCTTCATCAAGACCATC
CGGCTCGTGCGGCCAGTCGTGCCCTCGGCCACCGGGGAGCCCGATGGCCCTGAAGGGGAG
GCGCTGCCCGCCGCCTGCCCCGAGGAGCTGGCCTTCGAGGCGGAGGTGGAGTACAACGGG
GGCTTCCACCTGGCCATCGACGTGGACCTGGTCTTCGGCAAGTCCGCCTACTTGTTTGTC
AAGCTGTCCCGCGTGGTGGGAAGGCTGCGCTTGGTCTTTACGCGCGTGCCCTTCACCCAC
TGGTTCTTCTCCTTCGTGGAAGACCCGCTGATCGACTTCGAGGTGCGCTCCCAGTTTGAA
GGGCGGCCCATGCCCCAGCTCACCTCCATCATCGTCAACCAGCTCAAGAAGATCATCAAG
CGCAAGCACACCCTACCGAATTACAAGATCAGGTTTAAGCCGTTTTTTCCATACCAGACC
TTGCAAGGATTTGAAGAAGATGAAGAGCATATCCATATACAACAATGGGCACTTACTGAA
GGCCGTCTTAAAGTTACGTTGTTAGAATGTAGCAGGTTACTCATTTTTGGATCCTATGAC
AGAGAGGCAAATGTTCATTGTACACTTGAGTTAAGCAGTAGTGTTTGGGAAGAAAAACAG
AGGAGTTCTATTAAGACGGTTGAATTAATAAAAGGAAATTTACAAAGTGTTGGACTTACA
CTTCGTCTTGTCCAGTCAACTGATGGGTATGCTGGGCACGTCATCATTGAAACTGTGGCT
CCAAACTCGCCTGCTGCAATTGCAGATCTTCAGCGGGGAGATCGACTTATCGCCATTGGA
GGTGTGAAAATCACATCAACACTGCAAGTGTTGAAGCTTATCAAGCAGGCTGGTGACCGA
GTCCTGGTGTACTATGAAAGGCCTGTTGGCCAGAGTAATCAAGGTGCAGTGCTGCAAGAT
AACTTTGGCCAGTTGGAAGAAAACTTTTTGTCAAGCTCATGCCAATCGGGTTATGAAGAG
GAAGCTGCCGGGTTGACAGTAGATACTGAAAGTAGAGAGCTGGATTCTGAATTTGAAGAC
TTGGCAAGTGATGTCAGAGCACAAAATGAGTTCAAAGATGAGGCACAATCATTAAGTCAT
AGTCCCAAACGTGTTCCAACAACACTTTCTATTAAACCCCTTGGAGCTATATCACCAGTT
TTAAACCGTAAATTAGCTGTAGGAAGTCACCCACTACCACCGAAAATTCAGTCCAAAGAT
GGAAATAAACCTCCACCCCTAAAAACTTCTGAGATAACAGACCCAGCACAAGTGTCAAAA
CCAACCCAAGGATCTGCTTTCAAACCACCTGTGCCACCACGACCACAAGCGAAAGTTCCT
TTGCCTTCCGCCGATGCTCCAAATCAGGCAGAACCAGATGTTCTCGTTGAAAAGCCAGAG
AAGGTGGTGCCACCTCCTCTTGTAGATAAATCTGCTGAAAAGCAAGCAAAAAATGTGGAT
GCCATAGACGATGCAGCTGCACCTAAGCAATTTTTAGCAAAGCAAGAAGTGGCCAAAGAT
GTCACTTCAGAAACTTCCTGCCCTACTAAGGACAGTTCGGACGACCGTCAAACATGGGAA
TCATCAGAAATTCTTTATCGTAATAAGCTAGGAAAATGGACAAGAACCAGAGCATCCTGT
TTGTTTGACATAGAAGCCTGTCACAGGTACTTAAACATTGCATTGTGGTGCAGGGATCCT
TTCAAGTTGGGAGGTCTCATCTGTTTGGGGCATGTTAGTTTAAAACTTGAAGATGTGGCT
TTAGGATGCCTAGCTACATCAAACACGGAATACCTTTCCAAATTGAGACTGGAAGCCCCC
TCACCTAAGGCTATAGTCACTAGAACCGCACTACGCAATCTGAGTATGCAAAAGGGATTC
AATGACAAATTTTGCTATGGTGACATTACTATTCACTTCAAATATTTGAAAGAAGGAGAA
TCAGACCACCATGTAGTTACTAACGTAGAAAAAGAAAAAGAACCCCATTTGGTTGAAGAA
GTTTCTGTTCTCCCTAAAGAGGAGCAATTTGTTGGACAGATGGGTTTAACAGAAAACAAA
CACAGTTTTCAGGATACTCAGTTCCAGAACCCAACATGGTGTGACTACTGTAAGAAAAAA
GTTTGGACTAAAGCAGCTTCCCAGTGTATGTTTTGTGCTTATGTTTGCCATAAAAAATGT
CAAGAAAAGTGTCTAGCTGAGACTTCTGTTTGTGGAGCAACTGATAGGCGAATAGACAGG
ACACTGAAAAACCTTAGGCTGGAAGGACAGGAAACCCTCTTAGGCCTGCCTCCTCGTGTT
GATGCTGAAGCTAGCAAGTCAGTCAATAAAACAACAGGTTTGACAAGGCATATTATCAAT
ACTAGTTCTCGTTTATTAAATTTGCGTCAAGTCTCTAAAACTCGCCTTTCTGAACCAGGA
ACCGATCTCGTAGAACCTTCACCAAAACACACACCCAACACGTCAGACAACGAAGGCAGT
GACACGGAGGTCTGTGGTCCAAACAGTCCTTCTAAACGGGGAAACAGCACAGGAATAAAG
TTAGTGAGAAAAGAGGGTGGTCTGGATGACAGTGTTTTCATTGCAGTTAAAGAAATTGGT
CGTGATCTGTACAGGGGCTTGCCTACAGAGGAAAGGATCCAGAAACTAGAGTTCATGTTG
GATAAGCTACAGAATGAAATTGATCAGGAGTTGGAACACAATAATTCCCTTGTTAGAGAA
GAAAAAGAGACAACTGATACAAGGAAAAAATCACTTCTTTCTGCTGCCTTAGCTAAATCA
GGTGAAAGGCTACAAGCTCTAACACTTCTTATGATTCACTACAGAGCAGGCATTGAAGAT
ATAGAAACTTTAGAAAGTCTGTCTTTAGACCAGCACTCCAAAAAAATAAGCAAGTACACA
GATGATACAGAAGAAGACCTTGATAATGAAATAAGCCAACTAATAGACTCTCAGCCATTC
AGCAGCATATCAGATGACTTATTTGGCCCATCCGAGTCTGTGTAG
Protein Properties
Number of Residues 1154
Molecular Weight 128562.1
Theoretical pI 5.95
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>PDZ domain-containing protein 8
MGLLLMILASAVLGSFLTLLAQFFLLYRRQPEPPADEAARAGEGFRYIKPVPGLLLREYL
YGGGRDEEPSGAAPEGGATPTAAPETPAPPTRETCYFLNATILFLFRELRDTALTRRWVT
KKIKVEFEELLQTKTAGRLLEGLSLRDVFLGETVPFIKTIRLVRPVVPSATGEPDGPEGE
ALPAACPEELAFEAEVEYNGGFHLAIDVDLVFGKSAYLFVKLSRVVGRLRLVFTRVPFTH
WFFSFVEDPLIDFEVRSQFEGRPMPQLTSIIVNQLKKIIKRKHTLPNYKIRFKPFFPYQT
LQGFEEDEEHIHIQQWALTEGRLKVTLLECSRLLIFGSYDREANVHCTLELSSSVWEEKQ
RSSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIIETVAPNSPAAIADLQRGDRLIAIG
GVKITSTLQVLKLIKQAGDRVLVYYERPVGQSNQGAVLQDNFGQLEENFLSSSCQSGYEE
EAAGLTVDTESRELDSEFEDLASDVRAQNEFKDEAQSLSHSPKRVPTTLSIKPLGAISPV
LNRKLAVGSHPLPPKIQSKDGNKPPPLKTSEITDPAQVSKPTQGSAFKPPVPPRPQAKVP
LPSADAPNQAEPDVLVEKPEKVVPPPLVDKSAEKQAKNVDAIDDAAAPKQFLAKQEVAKD
VTSETSCPTKDSSDDRQTWESSEILYRNKLGKWTRTRASCLFDIEACHRYLNIALWCRDP
FKLGGLICLGHVSLKLEDVALGCLATSNTEYLSKLRLEAPSPKAIVTRTALRNLSMQKGF
NDKFCYGDITIHFKYLKEGESDHHVVTNVEKEKEPHLVEEVSVLPKEEQFVGQMGLTENK
HSFQDTQFQNPTWCDYCKKKVWTKAASQCMFCAYVCHKKCQEKCLAETSVCGATDRRIDR
TLKNLRLEGQETLLGLPPRVDAEASKSVNKTTGLTRHIINTSSRLLNLRQVSKTRLSEPG
TDLVEPSPKHTPNTSDNEGSDTEVCGPNSPSKRGNSTGIKLVRKEGGLDDSVFIAVKEIG
RDLYRGLPTEERIQKLEFMLDKLQNEIDQELEHNNSLVREEKETTDTRKKSLLSAALAKS
GERLQALTLLMIHYRAGIEDIETLESLSLDQHSKKISKYTDDTEEDLDNEISQLIDSQPF
SSISDDLFGPSESV
GenBank ID Protein 29789403
UniProtKB/Swiss-Prot ID Q8NEN9
UniProtKB/Swiss-Prot Entry Name PDZD8_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_173791.3
GeneCard ID PDZD8
GenAtlas ID PDZD8
HGNC ID HGNC:26974
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  6. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  7. Lee SY, Obata Y, Yoshida M, Stockert E, Williamson B, Jungbluth AA, Chen YT, Old LJ, Scanlan MJ: Immunomic analysis of human sarcoma. Proc Natl Acad Sci U S A. 2003 Mar 4;100(5):2651-6. Epub 2003 Feb 24. [PubMed:12601173 ]