Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10969
Secondary Accession Numbers
  • 17283
Name Proto-oncogene vav
Synonyms Not Available
Gene Name VAV1
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function Couples tyrosine kinase signals with the activation of the Rho/Rac GTPases, thus leading to cell differentiation and/or proliferation
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
binding
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
protein binding
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
intracellular signaling pathway
signaling
signaling pathway
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.2
SNPs VAV1
Gene Sequence
>2538 bp
ATGGAGCTGTGGCGCCAATGCACCCACTGGCTCATCCAGTGCCGGGTGCTGCCGCCCAGC
CACCGCGTGACCTGGGATGGGGCTCAGGTGTGTGAACTGGCCCAGGCCCTCCGGGATGGT
GTCCTTCTGTGTCAGCTGCTTAACAACCTGCTACCCCATGCCATCAACCTGCGTGAGGTC
AACCTGCGCCCCCAGATGTCCCAGTTCCTGTGCCTTAAGAACATTAGAACCTTCCTGTCC
ACCTGCTGTGAGAAGTTCGGCCTCAAGCGGAGCGAGCTCTTCGAAGCCTTTGACCTCTTC
GATGTGCAGGATTTTGGCAAGGTCATCTACACCCTGTCTGCTCTGTCCTGGACCCCGATC
GCCCAGAACAGGGGGATCATGCCCTTCCCCACCGAGGAGGAGAGTGTAGGTGATGAAGAC
ATCTACAGTGGCCTGTCCGACCAGATCGACGACACGGTGGAGGAGGATGAGGACCTGTAT
GACTGCGTGGAGAATGAGGAGGCGGAAGGCGACGAGATCTATGAGGACCTCATGCGCTCG
GAGCCCGTGTCCATGCCGCCCAAGATGACAGAGTATGACAAGCGCTGCTGCTGCCTGCGG
GAGATCCAGCAGACGGAGGAGAAGTACACTGACACGCTGGGCTCCATCCAGCAGCATTTC
TTGAAGCCCCTGCAACGGTTCCTGAAACCTCAAGACATTGAGATCATCTTTATCAACATT
GAGGACCTGCTTCGTGTTCATACTCACTTCCTAAAGGAGATGAAGGAAGCCCTGGGCACC
CCTGGCGCAGCCAATCTCTACCAGGTCTTCATCAAATACAAGGAGAGGTTCCTCGTCTAT
GGCCGCTACTGCAGCCAGGTGGAGTCAGCCAGCAAACACCTGGACCGTGTGGCCGCAGCC
CGGGAGGACGTGCAGATGAAGCTGGAGGAATGTTCTCAGAGAGCCAACAACGGGAGGTTC
ACCCTGCGGGACCTGCTGATGGTGCCTATGCAGCGAGTTCTCAAATATCACCTCCTTCTC
CAGGAGCTGGTGAAACACACGCAGGAGGCGATGGAGAAGGAGAACCTGCGGCTGGCCCTG
GATGCCATGAGGGACCTGGCTCAGTGCGTGAACGAGGTCAAGCGAGACAACGAGACACTG
CGACAGATCACCAATTTCCAGCTGTCCATTGAGAACCTGGACCAGTCTCTGGCTCACTAT
GGCCGGCCCAAGATCGACGGGGAACTCAAGATCACCTCGGTGGAACGGCGCTCCAAGATG
GACAGGTATGCCTTCCTGCTCGACAAAGCTCTACTCATCTGTAAGCGCAGGGGAGACTCC
TATGACCTCAAGGACTTTGTAAACCTGCACAGCTTCCAGGTTCGGGATGACTCTTCAGGA
GACCGAGACAACAAGAAGTGGAGCCACATGTTCCTCCTGATCGAGGACCAAGGTGCCCAG
GGCTATGAGCTGTTCTTCAAGACAAGAGAATTGAAGAAGAAGTGGATGGAGCAGTTTGAG
ATGGCCATCTCCAACATCTATCCGGAGAATGCCACCGCCAACGGGCATGACTTCCAGATG
TTCTCCTTTGAGGAGACCACATCCTGCAAGGCCTGTCAGATGCTGCTTAGAGGTACCTTC
TATCAGGGCTACCGCTGCCATCGGTGCCGGGCATCTGCACACAAGGAGTGTCTGGGGAGG
GTCCCTCCATGTGGCCGACATGGGCAAGATTTCCCAGGAACTATGAAGAAGGACAAACTA
CATCGCAGGGCTCAGGACAAAAAGAGGAATGAGCTGGGTCTGCCCAAGATGGAGGTGTTT
CAGGAATACTACGGGCTTCCTCCACCCCCTGGAGCCATTGGACCCTTTCTACGGCTCAAC
CCTGGAGACATTGTGGAGCTCACGAAGGCTGAGGCTGAACAGAACTGGTGGGAGGGCAGA
AATACATCTACTAATGAAATTGGCTGGTTTCCTTGTAACAGGGTGAAGCCCTATGTCCAT
GGCCCTCCTCAGGACCTGTCTGTTCATCTCTGGTACGCAGGCCCCATGGAGCGGGCAGGG
GCAGAGAGCATCCTGGCCAACCGCTCGGACGGGACTTTCTTGGTGCGGCAGAGGGTGAAG
GATGCAGCAGAATTTGCCATCAGCATTAAATATAACGTCGAGGTCAAGCACATTAAAATC
ATGACAGCAGAAGGACTGTACCGGATCACAGAGAAAAAGGCTTTCCGGGGGCTTACGGAG
CTGGTGGAGTTTTACCAGCAGAACTCTCTAAAGGATTGCTTCAAGTCTCTGGACACCACC
TTGCAGTTCCCCTTCAAGGAGCCTGAAAAGAGAACCATCAGCAGGCCAGCAGTGGGAAGC
ACAAAGTATTTTGGCACAGCCAAAGCCCGCTATGACTTCTGCGCCCGAGACCGATCAGAG
CTGTCGCTCAAGGAGGGTGACATCATCAAGATCCTTAACAAGAAGGGACAGCAAGGCTGG
TGGCGAGGGGAGATCTATGGCCGGGTTGGCTGGTTCCCTGCCAACTACGTGGAGGAAGAT
TATTCTGAATACTGCTGA
Protein Properties
Number of Residues 845
Molecular Weight 98313.4
Theoretical pI 6.59
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Proto-oncogene vav
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINI
EDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVF
QEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVH
GPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKI
MTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEED
YSEYC
GenBank ID Protein 3282619
UniProtKB/Swiss-Prot ID P15498
UniProtKB/Swiss-Prot Entry Name VAV_HUMAN
PDB IDs Not Available
GenBank Gene ID AF030227
GeneCard ID VAV1
GenAtlas ID VAV1
HGNC ID HGNC:12657
References
General References
  1. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Houlard M, Romero-Portillo F, Germani A, Depaux A, Regnier-Ricard F, Gisselbrecht S, Varin-Blank N: Characterization of VIK-1: a new Vav-interacting Kruppel-like protein. Oncogene. 2005 Jan 6;24(1):28-38. [PubMed:15558030 ]
  4. Lindholm CK, Henriksson ML, Hallberg B, Welsh M: Shb links SLP-76 and Vav with the CD3 complex in Jurkat T cells. Eur J Biochem. 2002 Jul;269(13):3279-88. [PubMed:12084069 ]
  5. Bustelo XR, Crespo P, Lopez-Barahona M, Gutkind JS, Barbacid M: Cbl-b, a member of the Sli-1/c-Cbl protein family, inhibits Vav-mediated c-Jun N-terminal kinase activation. Oncogene. 1997 Nov 20;15(21):2511-20. [PubMed:9399639 ]
  6. Nishihara H, Maeda M, Oda A, Tsuda M, Sawa H, Nagashima K, Tanaka S: DOCK2 associates with CrkL and regulates Rac1 in human leukemia cell lines. Blood. 2002 Dec 1;100(12):3968-74. Epub 2002 Jun 28. [PubMed:12393632 ]
  7. Yabana N, Shibuya M: Adaptor protein APS binds the NH2-terminal autoinhibitory domain of guanine nucleotide exchange factor Vav3 and augments its activity. Oncogene. 2002 Oct 31;21(50):7720-9. [PubMed:12400014 ]
  8. Germani A, Romero F, Houlard M, Camonis J, Gisselbrecht S, Fischer S, Varin-Blank N: hSiah2 is a new Vav binding protein which inhibits Vav-mediated signaling pathways. Mol Cell Biol. 1999 May;19(5):3798-807. [PubMed:10207103 ]
  9. Coppola J, Bryant S, Koda T, Conway D, Barbacid M: Mechanism of activation of the vav protooncogene. Cell Growth Differ. 1991 Feb;2(2):95-105. [PubMed:2069873 ]
  10. Denkinger DJ, Borges CR, Butler CL, Cushman AM, Kawahara RS: Genomic organization and regulation of the vav proto-oncogene. Biochim Biophys Acta. 2000 Apr 25;1491(1-3):253-62. [PubMed:10760587 ]
  11. Katzav S, Cleveland JL, Heslop HE, Pulido D: Loss of the amino-terminal helix-loop-helix domain of the vav proto-oncogene activates its transforming potential. Mol Cell Biol. 1991 Apr;11(4):1912-20. [PubMed:2005887 ]
  12. Katzav S, Martin-Zanca D, Barbacid M: vav, a novel human oncogene derived from a locus ubiquitously expressed in hematopoietic cells. EMBO J. 1989 Aug;8(8):2283-90. [PubMed:2477241 ]
  13. Ramos-Morales F, Romero F, Schweighoffer F, Bismuth G, Camonis J, Tortolero M, Fischer S: The proline-rich region of Vav binds to Grb2 and Grb3-3. Oncogene. 1995 Oct 19;11(8):1665-9. [PubMed:7478592 ]
  14. Adams JM, Houston H, Allen J, Lints T, Harvey R: The hematopoietically expressed vav proto-oncogene shares homology with the dbl GDP-GTP exchange factor, the bcr gene and a yeast gene (CDC24) involved in cytoskeletal organization. Oncogene. 1992 Apr;7(4):611-8. [PubMed:1565462 ]
  15. Fu C, Turck CW, Kurosaki T, Chan AC: BLNK: a central linker protein in B cell activation. Immunity. 1998 Jul;9(1):93-103. [PubMed:9697839 ]