You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP10974
Secondary Accession Numbers
  • 17288
Name Oxysterol-binding protein-related protein 2
Synonyms
  1. ORP-2
  2. OSBP-related protein 2
Gene Name OSBPL2
Protein Type Unknown
Biological Properties
General Function Involved in steroid metabolic process
Specific Function Binds phospholipids; exhibits strong binding to phosphatidic acid and weak binding to phosphatidylinositol 3- phosphate
Pathways Not Available
Reactions Not Available
GO Classification
Process
metabolic process
primary metabolic process
lipid metabolic process
steroid metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 20q13.3
SNPs OSBPL2
Gene Sequence
>1443 bp
ATGAACGGAGAGGAAGAATTCTTTGATGCCGTCACAGGCTTTGATTCTGATAACTCTTCT
GGGGAATTTTCAGAGGCAAATCAGAAAGTCACGGGAATGATTGACTTAGACACCAGCAAA
AATAATAGGATTGGGAAAACTGGGGAGAGGCCCTCTCAAGAGAACGGAATTCAGAAACAC
AGGACATCGCTGCCGGCTCCCATGTTCAGCAGAAGCGACTTCAGCGTGTGGACCATCCTG
AAGAAGTGTGTTGGCCTGGAGCTGTCCAAGATCACGATGCCAATCGCCTTCAACGAGCCT
CTGAGCTTCTTGCAGCGGATCACGGAGTACATGGAGCACGTGTACCTCATCCACAGGGCC
TCCTGCCAGCCCCAGCCCCTGGAGAGGATGCAGTCTGTGGCTGCTTTTGCTGTTTCGGCT
GTGGCTTCCCAGTGGGAGAGGACCGGCAAACCATTTAATCCACTCTTGGGAGAAACGTAT
GAATTAATCAGGGAAGATTTAGGATTCAGATTTATATCGGAACAGGTCAGTCACCACCCC
CCCATCAGTGCGTTCCACTCGGAAGGTCTCAACCATGACTTCCTGTTCCATGGCTCCATC
TACCCCAAGCTCAAGTTCTGGGGCAAAAGCGTGGAGGCGGAGCCCCGAGGCACCATCACC
CTGGAGCTGCTCAAACATAATGAAGCCTACACCTGGACCAACCCCACCTGCTGCGTCCAC
AACGTCATCATCGGGAAGCTGTGGATAGAGCAGTATGGGACAGTGGAGATTTTAAACCAC
AGAACTGGACATAAGTGTGTGCTTCACTTTAAACCGTGTGGATTATTTGGAAAAGAACTT
CACAAGGTGGAAGGACACATTCAAGACAAAAACAAAAAGAAGCTCTTTATGATCTATGGC
AAATGGACGGAATGTTTGTGGGGCATAGATCCTGTTTCGTATGAATCCTTCAAGAAGCAG
GAGAGGAGAGGTGACCACCTGAGAAAGGCCAAGCTGGATGAAGACTCCGGGAAGGCTGAC
AGCGACGTGGCTGACGACGTGCCTGTGGCCCAGGAGACCGTGCAGGTCATTCCTGGCAGC
AAGCTGCTCTGGAGGATCAACACCCGGCCCCCCAACTCTGCCCAGATGTATAATTTCACC
AGTTTCACTGTGAGCCTCAACGAGCTGGAGACAGGCATGGAGAAGACCCTGCCACCCACG
GACTGCCGCCTGCGCCCTGACATCCGCGGCATGGAGAATGGCAACATGGATCTGGCCAGC
CAGGAGAAGGAGCGGCTGGAGGAGAAGCAGAGAGAAGCACGGAGGGAGCGGGCCAAGGAG
GAGGCAGAGTGGCAGACGAGGTGGTTCTACCCAGGCAATAACCCCTACACTGGGACCCCC
GACTGGTTGTATGCAGGGGATTACTTTGAGCGGAATTTCTCCGACTGCCCAGATATCTAC
TGA
Protein Properties
Number of Residues 480
Molecular Weight 55200.9
Theoretical pI 6.31
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Oxysterol-binding protein-related protein 2
MNGEEEFFDAVTGFDSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKH
RTSLPAPMFSRSDFSVWTILKKCVGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHRA
SCQPQPLERMQSVAAFAVSAVASQWERTGKPFNPLLGETYELIREDLGFRFISEQVSHHP
PISAFHSEGLNHDFLFHGSIYPKLKFWGKSVEAEPRGTITLELLKHNEAYTWTNPTCCVH
NVIIGKLWIEQYGTVEILNHRTGHKCVLHFKPCGLFGKELHKVEGHIQDKNKKKLFMIYG
KWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVAQETVQVIPGS
KLLWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPTDCRLRPDIRGMENGNMDLAS
QEKERLEEKQREARRERAKEEAEWQTRWFYPGNNPYTGTPDWLYAGDYFERNFSDCPDIY
GenBank ID Protein 21450853
UniProtKB/Swiss-Prot ID Q9H1P3
UniProtKB/Swiss-Prot Entry Name OSBL2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_144498.1
GeneCard ID OSBPL2
GenAtlas ID OSBPL2
HGNC ID HGNC:15761
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  4. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. [PubMed:9872452 ]
  5. Xu Y, Liu Y, Ridgway ND, McMaster CR: Novel members of the human oxysterol-binding protein family bind phospholipids and regulate vesicle transport. J Biol Chem. 2001 May 25;276(21):18407-14. Epub 2001 Feb 26. [PubMed:11279184 ]
  6. Jaworski CJ, Moreira E, Li A, Lee R, Rodriguez IR: A family of 12 human genes containing oxysterol-binding domains. Genomics. 2001 Dec;78(3):185-96. [PubMed:11735225 ]
  7. Lehto M, Laitinen S, Chinetti G, Johansson M, Ehnholm C, Staels B, Ikonen E, Olkkonen VM: The OSBP-related protein family in humans. J Lipid Res. 2001 Aug;42(8):1203-13. [PubMed:11483621 ]