You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11013
Secondary Accession Numbers
  • 17338
Name Protein RCC2
Synonyms
  1. RCC1-like protein TD-60
  2. Telophase disk protein of 60 kDa
Gene Name RCC2
Protein Type Enzyme
Biological Properties
General Function Involved in cell division
Specific Function Required for completion of mitosis and cytokinesis. May function as a guanine nucleotide exchange factor for the small GTPase RAC1
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. nucleolus
  4. cytoskeleton
  5. Chromosome
  6. centromere
  7. spindle
Gene Properties
Chromosome Location Chromosome:1
Locus 1p36.13
SNPs RCC2
Gene Sequence
>1569 bp
ATGCCCAGGAAGAAGGCGGCGGCGGCGGCCTGGGAGGAGCCGAGCTCGGGCAACGGCACT
GCCCGCGCCGGGCCCAGGAAACGCGGCGGCCCGGCGGGCAGGAAGCGCGAGCGGCCCGAG
CGCTGCAGTAGCAGCAGCGGCGGCGGCAGCAGCGGCGACGAGGACGGCCTGGAGCTCGAC
GGGGCCCCCGGCGGGGGCAAGCGCGCGGCGCGGCCGGCGACAGCAGGCAAGGCGGGCGGC
GCGGCCGTGGTCATCACCGAACCCGAGCACACCAAGGAGCGCGTCAAACTTGAAGGGTCA
AAGTGCAAAGGGCAGCTTTTGATTTTTGGGGCAACCAACTGGGACTTGATTGGTCGAAAA
GAAGTGCCTAAACAGCAAGCTGCTTACCGCAATCTCGGTCAGAATTTGTGGGGGCCCCAC
AGATATGGGTGCCTGGCGGGGGTCCGGGTGCGGACAGTGGTCTCGGGCTCGTGTGCTGCA
CACAGCCTCCTCATCACCACGGAAGGGAAGCTGTGGAGCTGGGGTCGAAATGAGAAGGGG
CAGCTGGGACATGGTGACACCAAGAGAGTAGAAGCCCCTAGACTCATCGAGGGTCTTAGC
CACGAAGTGATTGTGTCTGCAGCATGTGGGCGGAACCACACCTTGGCCTTGACGGAAACG
GGCTCCGTGTTTGCGTTTGGGGAAAACAAGATGGGGCAGCTGGGCCTTGGCAACCAGACA
GACGCTGTTCCCAGCCCCGCGCAGATAATGTACAACGGCCAGCCAATTACCAAAATGGCC
TGTGGGGCTGAATTCAGTATGATAATGGACTGCAAAGGAAACCTCTATTCCTTTGGGTGC
CCTGAATATGGTCAGCTGGGACACAACTCAGATGGGAAGTTCATCGCCCGGGCACAGCGG
ATAGAGTACGACTGTGAACTAGTTCCCCGGCGAGTGGCCATCTTCATTGAGAAGACGAAA
GATGGACAGATTCTGCCTGTACCAAACGTGGTTGTACGAGACGTGGCCTGTGGCGCTAAC
CACACGCTGGTCCTGGACTCCCAGAAGCGAGTCTTCTCCTGGGGCTTTGGTGGCTATGGC
CGGCTGGGCCACGCAGAGCAGAAGGATGAGATGGTCCCCCGCCTGGTGAAGCTGTTTGAC
TTCCCTGGGCGTGGGGCTTCCCAGATCTATGCTGGTTACACCTGCTCCTTTGCTGTCAGT
GAAGTGGGTGGTCTGTTTTTCTGGGGGGCCACCAACACCTCCCGTGAATCTACCATGTAC
CCAAAAGCAGTGCAGGACCTCTGCGGCTGGAGAATCCGGAGCCTGGCTTGTGGGAAGAGC
AGCATCATTGTGGCCGCCGATGAGAGCACCATCAGCTGGGGTCCGTCACCGACCTTTGGG
GAACTGGGCTACGGGGACCACAAGCCCAAGTCTTCCACTGCAGCCCAGGAGGTAAAGACT
CTGGATGGCATTTTCTCAGAGCAGGTCGCCATGGGCTACTCACACTCCTTGGTGATAGCA
AGAGATGAAAGTGAGACTGAGAAAGAGAAGATCAAGAAACTGCCAGAATACAACCCCCGA
ACCCTCTGA
Protein Properties
Number of Residues 522
Molecular Weight 56084.1
Theoretical pI 9.0
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Protein RCC2
MPRKKAAAAAWEEPSSGNGTARAGPRKRGGPAGRKRERPERCSSSSGGGSSGDEDGLELD
GAPGGGKRAARPATAGKAGGAAVVITEPEHTKERVKLEGSKCKGQLLIFGATNWDLIGRK
EVPKQQAAYRNLGQNLWGPHRYGCLAGVRVRTVVSGSCAAHSLLITTEGKLWSWGRNEKG
QLGHGDTKRVEAPRLIEGLSHEVIVSAACGRNHTLALTETGSVFAFGENKMGQLGLGNQT
DAVPSPAQIMYNGQPITKMACGAEFSMIMDCKGNLYSFGCPEYGQLGHNSDGKFIARAQR
IEYDCELVPRRVAIFIEKTKDGQILPVPNVVVRDVACGANHTLVLDSQKRVFSWGFGGYG
RLGHAEQKDEMVPRLVKLFDFPGRGASQIYAGYTCSFAVSEVGGLFFWGATNTSRESTMY
PKAVQDLCGWRIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT
LDGIFSEQVAMGYSHSLVIARDESETEKEKIKKLPEYNPRTL
GenBank ID Protein 209969703
UniProtKB/Swiss-Prot ID Q9P258
UniProtKB/Swiss-Prot Entry Name RCC2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001136204.1
GeneCard ID RCC2
GenAtlas ID RCC2
HGNC ID HGNC:30297
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  8. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  9. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  10. Nagase T, Kikuno R, Ishikawa K, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Apr 28;7(2):143-50. [PubMed:10819331 ]
  11. Scherl A, Coute Y, Deon C, Calle A, Kindbeiter K, Sanchez JC, Greco A, Hochstrasser D, Diaz JJ: Functional proteomic analysis of human nucleolus. Mol Biol Cell. 2002 Nov;13(11):4100-9. [PubMed:12429849 ]
  12. Mollinari C, Reynaud C, Martineau-Thuillier S, Monier S, Kieffer S, Garin J, Andreassen PR, Boulet A, Goud B, Kleman JP, Margolis RL: The mammalian passenger protein TD-60 is an RCC1 family member with an essential role in prometaphase to metaphase progression. Dev Cell. 2003 Aug;5(2):295-307. [PubMed:12919680 ]
  13. Andreassen PR, Palmer DK, Wener MH, Margolis RL: Telophase disc: a new mammalian mitotic organelle that bisects telophase cells with a possible function in cytokinesis. J Cell Sci. 1991 Jul;99 ( Pt 3):523-34. [PubMed:1939370 ]
  14. Martineau SN, Andreassen PR, Margolis RL: Delay of HeLa cell cleavage into interphase using dihydrocytochalasin B: retention of a postmitotic spindle and telophase disc correlates with synchronous cleavage recovery. J Cell Biol. 1995 Oct;131(1):191-205. [PubMed:7559776 ]
  15. Martineau-Thuillier S, Andreassen PR, Margolis RL: Colocalization of TD-60 and INCENP throughout G2 and mitosis: evidence for their possible interaction in signalling cytokinesis. Chromosoma. 1998 Dec;107(6-7):461-70. [PubMed:9914378 ]