You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11467
Secondary Accession Numbers
  • 17816
Name Rho guanine nucleotide exchange factor 37
Synonyms Not Available
Gene Name ARHGEF37
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function May act as a guanine nucleotide exchange factor (GEF)
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
intracellular
Function
small gtpase regulator activity
binding
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
protein binding
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:5
Locus 5q32
SNPs ARHGEF37
Gene Sequence
>2028 bp
ATGGCCAAGCATGGAGCCGACGAGCCATCCTCCAGGTCAGGGAGTCCGGACAGGGAAGGT
AGGGCCTCTGAGGACAGATCGCTGCTTCATCAGAGGCTGGCTGTCCGGGAGCTCATCGAC
ACTGAGGTCTCCTACTTGCACATGCTCCAGCTCTGTGCCTCTGACATCAGGAGCCGCCTC
CAGCAGTTGCCGCAGGGAGATCTGGATGTCCTGTTCTCAAACATTGATGATATCATCAAA
GTGAACAGCAGATTCCTCCATGATCTGCAGGAGACAGCCTCCAAGGAAGAGGAACAAGTG
CAGCTAGTTGGTAACATATTTCTGGAATTCCAAGAGGAGTTGGAGCAAGTCTATAAGGTC
TACTGTGCCAGCTACGACCAGGCCTTGCTACTGGTGGACACGTACCGGAAGGAGCCGGAG
CTGCAGCGGCACATCCAGGGCATCGTTGAGGCGGTGGTGCCGCAAGCTGGATCTTCAGGC
CTCAGTTTCTTGCTGGTAATTCCTCTGCAGAGGATCACCAGGTACCCACTGCTGCTGCAG
AAAATCCTGGAGAACACAGTCCCTGATGCCAGTGCCTATCCTGTCCTTCAGAGGGCTGTC
TCTGCCCTCCAGGACGTGAACACCAATATCAATGAGTACAAGATGCGCAAGGAAGTGGCC
TCCAAGTACACCAAGGTAGAGCAGCTGACCCTCCGGGAGCGGCTGGCCCGCATCAACACA
CACACCCTCTCCAAGAAGACCACCCGGCTGAGCCAGCTGCTGAAGCAGGAGGCGGGGCTG
ATCCCCAGGACAGAAGACAAGGAATTTGATGATTTAGAAGAGAGGTTCCAGTGGGTGTCT
CTGTGTGTGACTGAGCTGAAGAACAACGTGGCTGCTTACCTGGACAATCTGCAGGCTTTC
CTCTACTTCAGGCCGCACGAATACAATCTGGACATCCCCGAGGGGCCTGCAGTGCAGTAT
TGCAATTTGGCAAGAGACCTTCACCTTGAGGCCTTCCTGAAATTTAAGCAACGGCTAGAA
GGCCTGGTGTGGCAGCCACTGTGCAGCCTGGCCAAAGCCCTGCTTGGCCCTCAGAACCTG
ATCAAGAAGCGTCTGGACAAGCTACTGGACTTTGAGCGGGTGGAAGAGAAGCTGCTGGAG
GTGGGCAGTGTGACCTACCAGGAGGAGGCCGCCCGGCACACATACCAGGCACTCAACTCG
CTGCTAGTGGCTGAGCTCCCACAGTTTAACCAGCTGGTCATGCAGTGGCTGGGCCAGATC
MTGTGCACATTCGTGACCCTCCAGAGGGACCTTGCAAAGCAAGTGCTGCAGAGGGCAGAG
GGAAGCATGGCCCAGCTGCCCCACCACCACGTCCCAGAGCCTGCCTTCAGGAAGCTGGTG
GAGGACGCACTGGGCCGGACGAGTAACCAGCTTCGCTCCTTTCAAGAGACCTTTGAGAAA
GTGCAGCCACCTCCCACCACACAACYGCTCCTTCCAGGGTCTGAACGCCAGGTGCAGGCT
CTCCTGAGCAGGTATGGCCCTGGGAAGCTGTACCAGGTGACAAGCAACATCAGTGGGACT
GGGACTCTGGACCTGACTCTGCCTCGGGGCCAAATCGTGGCCATCCTTCAAAACAAGGAC
ACCAAAGGCAACAGCGGCCGCTGGCTGGTGGACACCGGGGGACATCGTGGGTATGTGCCG
GCTGGGAAACTRCAGCTGTACCATGTGGTCCCCAGTGCAGAGGAGCTCAGAAGGCAGGCG
GGGCTGAACAAAGACCCCCGATGTCTAACACCGGAGCCCAGCCCAGCTCTAGTGCCCTCT
ATTCCCACCRTGAACCAGGTCATAGCCGCGTACCCTTTTGTGGCCAGAAGCAGCCATGAA
GTGAGCCTGCAGGCAGGCCAGCCTGTGACCATCCTGGAGGCCCAGGACAAGAAGGGGAAC
CCTGAGTGGAGCCTGGTGGAAGTGAATGGACAGAGGGGTTATGTGCCTTCTGGCTTCTTG
GCCAGGGCTCGGAGCCCAGTTCTGTGGGGCTGGAGTCTGCCCTCTTAG
Protein Properties
Number of Residues 675
Molecular Weight 76277.5
Theoretical pI 6.92
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rho guanine nucleotide exchange factor 37
MAKHGADEPSSRSGSPDREGRASEDRSLLHQRLAVRELIDTEVSYLHMLQLCASDIRSRL
QQLPQGDLDVLFSNIDDIIKVNSRFLHDLQETASKEEEQVQLVGNIFLEFQEELEQVYKV
YCASYDQALLLVDTYRKEPELQRHIQGIVEAVVPQAGSSGLSFLLVIPLQRITRYPLLLQ
KILENTVPDASAYPVLQRAVSALQDVNTNINEYKMRKEVASKYTKVEQLTLRERLARINT
HTLSKKTTRLSQLLKQEAGLIPRTEDKEFDDLEERFQWVSLCVTELKNNVAAYLDNLQAF
LYFRPHEYNLDIPEGPAVQYCNLARDLHLEAFLKFKQRLEGLVWQPLCSLAKALLGPQNL
IKKRLDKLLDFERVEEKLLEVGSVTYQEEAARHTYQALNSLLVAELPQFNQLVMQWLGQI
MCTFVTLQRDLAKQVLQRAEGSMAQLPHHHVPEPAFRKLVEDALGRTSNQLRSFQETFEK
VQPPPTTQPLLPGSERQVQALLSRYGPGKLYQVTSNISGTGTLDLTLPRGQIVAILQNKD
TKGNSGRWLVDTGGHRGYVPAGKLQLYHVVPSAEELRRQAGLNKDPRCLTPEPSPALVPS
IPTMNQVIAAYPFVARSSHEVSLQAGQPVTILEAQDKKGNPEWSLVEVNGQRGYVPSGFL
ARARSPVLWGWSLPS
GenBank ID Protein 121308635
UniProtKB/Swiss-Prot ID A1IGU5
UniProtKB/Swiss-Prot Entry Name ARH37_HUMAN
PDB IDs Not Available
GenBank Gene ID AB199796
GeneCard ID ARHGEF37
GenAtlas ID ARHGEF37
HGNC ID HGNC:34430
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]