Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11472
Secondary Accession Numbers
  • 17821
Name Rho guanine nucleotide exchange factor 18
Synonyms
  1. 114 kDa Rho-specific guanine nucleotide exchange factor
  2. SA-RhoGEF
  3. Septin-associated RhoGEF
  4. p114-Rho-GEF
  5. p114RhoGEF
Gene Name ARHGEF18
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPases. May play a role in actin cytoskeleton reorganization in different tissues since its activation induces formation of actin stress fibers. Also act as a GEF for RAC1, inducing production of reactive oxygen species (ROS). Does not act as a GEF for CDC42. The G protein beta-gamma (Gbetagamma) subunits of heterotrimeric G proteins act as activators, explaining the integrated effects of LPA and other G-protein coupled receptor agonists on actin stress fiber formation, cell shape change and ROS production
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.3
SNPs ARHGEF18
Gene Sequence
>3522 bp
ATGGTCACAGTGGGGACCAATATCCTGCCCTCCAGACCCGCTGCTTCAGCCAATACAGCA
AGGGAAGACGCAGCTCTGTTTTCTAGAAGGATCCCACCGAGGCATAAAAACGGCGCAGCC
CAGCCTGGCGCCGCGCCGGGTCCCGGAGCCCCGGGCGCGAACATGGGGAATGCGCACTCC
AAAAGCGGGGACAGGCACAGCGCGCTCCCCGGCCGCCCCGAGCTGTCTTTTTACGGCTCT
TTCCCCAGGAAATGGAGCGAGAACGTCTTCTTGGATAACGAGCTGCTGACCTCCAAGATC
CTGTCTGTGCTGCGGCCGCAGTCGGAGCGGGGCTTCCGCGCCGGGGACCTCCGCTACCCG
ACCCACTTTCTCAGCACCAACTCTGTCCTTGCCTCTGTCACAGCCTCGCTCAAGGAGCAC
CCCCGGGGCACCCTCCTGTCCGATGGCAGCCCGGCCCTGTCCAGGAATGTCGGTATGACG
GTCTCTCAGAAAGGGGGTCCCCAGCCAACACCGAGCCCGGCTGGCCCTGGGACGCAACTC
GGACCAATCACAGGAGAGATGGATGAAGCCGATTCTGCGTTTTTAAAATTTAAGCAGACA
GCTGATGACTCTCTGTCCCTTACATCTCCAAACACCGAGTCCATTTTTGTAGAAGATCCC
TACACCGCCTCGCTGAGGAGTGAGATTGAGTCAGACGGCCACGAGTTTGAAGCTGAGTCC
TGGAGCCTCGCCGTGGATGCAGCCTACGCCAAGAAGCAAAAGAGGGAGGTGGTGAAAAGA
CAAGATGTCCTTTATGAGCTGATGCAGACAGAGGTGCACCACGTGCGGACGCTCAAGATC
ATGCTGAAGGTGTACTCCAGGGCCCTGCAGGAGGAGCTGCAGTTCAGCAGCAAGGCCATT
GGCCGCCTCTTCCCATGCGCTGACGACCTGCTGGAGACGCACAGCCACTTCCTCGCTCGG
CTCAAGGAGCGCCGCCAGGAGTCCCTGGAGGAGGGCAGTGACCGGAATTATGTCATCCAG
AAAATCGGCGACCTCCTGGTTCAGCAGTTTTCAGGTGAAAATGGGGAGAGAATGAAAGAA
AAGTACGGTGTGTTTTGTAGTGGCCACAATGAAGCTGTTAGTCATTACAAGTTGCTGCTT
CAGCAAAACAAGAAATTTCAAAACTTGATCAAGAAAATTGGCAACTTCTCCATCGTGCGG
CGGCTTGGCGTGCAGGAGTGCATTCTCCTGGTTACACAACGCATAACCAAATACCCAGTG
CTGGTGGAGCGCATCATCCAGAACACGGAAGCTGGCACTGAGGACTATGAAGACCTGACC
CAGGCCTTGAACCTCATCAAAGATATCATCTCACAAGTGGACGCCAAGGTCAGTGAGTGT
GAGAAGGGCCAGCGCCTCAGGGAGATCGCAGGGAAGATGGACCTGAAGTCTTCCAGCAAA
CTCAAGAACGGGCTCACCTTCCGCAAGGAAGACATGCTTCAGCGGCAGCTCCACCTGGAG
GGCATGCTATGCTGGAAGACCACATCAGGGCGCTTGAAAGATATCCTGGCTATCCTGCTG
ACCGACGTACTTTTGCTGCTACAAGAAAAAGATCAGAAATACGTCTTTGCTTCTGTGGAC
TCAAAGCCACCCGTCATCTCGTTACAAAAGCTCATCGTGAGGGAAGTGGCCAACGAGGAG
AAAGCGATGTTTCTGATCAGCGCCTCCTTGCAAGGGCCGGAGATGTATGAAATCTACACG
AGCTCCAAAGAGGACAGGAACGCCTGGATGGCCCACATCCAAAGGGCTGTGGAGAGCTGC
CCTGACGAGGAGGAGGGGCCCTTCAGCCTGCCCGAAGAGGAAAGGAAGGTGGTCGAGGCC
CGCGCCACGAGACTCCGGGACTTTCAAGAGCGGTTGAGCATGAAAGACCAGCTGATCGCA
CAGAGCCTCCTAGAGAAACAGCAGATCTACCTGGAGATGGCCGAGATGGGCGGCCTCGAA
GACCTGCCCCAGCCCCGAGGCCTATTCCGTGGAGGGGACCCATCCGAGACCCTGCAGGGG
GAGCTAATTCTCAAGTCGGCCATGAGCGAGATCGAGGGCATCCAGAGCCTGATCTGCAGG
CAGCTGGGCAGCGCCAACGGCCAGGCGGAAGACGGAGGCAGCTCCACAGGCCCGCCCAGG
AGGGCTGAGACCTTCGCGGGCTACGACTGCACAAACAGCCCCACCAAGAATGGCAGTTTC
AAGAAGAAAGTCAGCAGCACTGACCCCAGGCCCCGAGACTGGCGAGGCCCCCCAAACAGC
CCGGACTTGAAGCTCAGTGACAGTGACATTCCTGGGAGCTCTGAGGAATCGCCGCAGGTG
GTGGAGGCGCCAGGCACGGAATCCGATCCCCGTCTGCCCACCGTCCTGGAGTCGGAGCTT
GTCCAGCGGATCCAGACACTGTCCCAGCTGCTCCTGAACCTTCAGGCGGTAATCGCCCAC
CAGGACAGCTATGTGGAGACGCAGCGGGCTGCCATCCAGGAGCGGGAGAAGCAGTTCCGG
CTGCAGTCGACGCGTGGGAACCTGCTGCTGGAGCAGGAGCGGCAACGCAACTTCGAGAAG
CAGCGGGAGGAGCGCGCGGCCCTGGAGAAGCTGCAGAGCCAGCTGCGGCACGAGCAGCAG
CGCTGGGAGCGCGAGCGCCAGTGGCAGCACCAGGAGCTGGAGCGTGCGGGCGCGCGGCTG
CAGGAGCGCGAGGGCGAGGCGCGGCAGCTACGCGAGCGGCTGGAGCAGGAGCGGGCCGAG
CTGGAGCGCCAGCGCCAGGCCTACCAGCACGACCTGGAGCGGCTGCGCGAGGCCCAGCGT
GCCGTGGAGCGCGAGCGGGAGCGCCTGGAGCTGCTGCGCCGCCTCAAGAAGCAGAACACC
GCGCCAGGCGCGCTGCCGCCCGACACACTGGCCGAGGCCCAGCCCCCAAGCCACCCTCCC
AGCTTCAACGGGGAAGGGCTGGAGGGCCCTCGTGTGAGCATGCTGCCATCCGGCGTGGGG
CCAGAGTACGCAGAGCGCCCCGAGGTGGCTCGCCGGGACAGCGCCCCCACCGAGAACCGG
CTGGCCAAGAGCGATGTGCCCATCCAGCTGCTCAGCGCCACCAACCAGTTCCAGAGGCAG
GCGGCCGTGCAGCAGCAGATCCCCACCAAGCTGGCGGCCTCCACCAAGGGTGGCAAGGAC
AAGGGCGGCAAGAGCAGGGGCTCTCAGCGCTGGGAGAGCTCAGCGTCCTTCGACCTGAAG
CAGCAGCTGCTGCTCAACAAGCTCATGGGGAAAGATGAGAGCACCTCACGGAACCGCCGC
TCGCTGAGCCCTATCCTGCCCGGCAGACACAGTCCTGCGCCCCCACCAGACCCTGGCTTC
CCCGCCCCGAGCCCACCGCCAGCTGACAGCCCCTCCGAGGGCTTCTCTCTCAAGGCCGGG
GGCACAGCCCTCCTGCCCGGGCCCCCAGCTCCCTCGCCACTGCCGGCCACACCACTCAGC
GCCAAGGAGGACGCCAGCAAAGAAGACGTCATCTTCTTCTAA
Protein Properties
Number of Residues 1173
Molecular Weight 130779.3
Theoretical pI 7.08
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rho guanine nucleotide exchange factor 18
MVTVGTNILPSRPAASANTAREDAALFSRRIPPRHKNGAAQPGAAPGPGAPGANMGNAHS
KSGDRHSALPGRPELSFYGSFPRKWSENVFLDNELLTSKILSVLRPQSERGFRAGDLRYP
THFLSTNSVLASVTASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQL
GPITGEMDEADSAFLKFKQTADDSLSLTSPNTESIFVEDPYTASLRSEIESDGHEFEAES
WSLAVDAAYAKKQKREVVKRQDVLYELMQTEVHHVRTLKIMLKVYSRALQEELQFSSKAI
GRLFPCADDLLETHSHFLARLKERRQESLEEGSDRNYVIQKIGDLLVQQFSGENGERMKE
KYGVFCSGHNEAVSHYKLLLQQNKKFQNLIKKIGNFSIVRRLGVQECILLVTQRITKYPV
LVERIIQNTEAGTEDYEDLTQALNLIKDIISQVDAKVSECEKGQRLREIAGKMDLKSSSK
LKNGLTFRKEDMLQRQLHLEGMLCWKTTSGRLKDILAILLTDVLLLLQEKDQKYVFASVD
SKPPVISLQKLIVREVANEEKAMFLISASLQGPEMYEIYTSSKEDRNAWMAHIQRAVESC
PDEEEGPFSLPEEERKVVEARATRLRDFQERLSMKDQLIAQSLLEKQQIYLEMAEMGGLE
DLPQPRGLFRGGDPSETLQGELILKSAMSEIEGIQSLICRQLGSANGQAEDGGSSTGPPR
RAETFAGYDCTNSPTKNGSFKKKVSSTDPRPRDWRGPPNSPDLKLSDSDIPGSSEESPQV
VEAPGTESDPRLPTVLESELVQRIQTLSQLLLNLQAVIAHQDSYVETQRAAIQEREKQFR
LQSTRGNLLLEQERQRNFEKQREERAALEKLQSQLRHEQQRWERERQWQHQELERAGARL
QEREGEARQLRERLEQERAELERQRQAYQHDLERLREAQRAVERERERLELLRRLKKQNT
APGALPPDTLAEAQPPSHPPSFNGEGLEGPRVSMLPSGVGPEYAERPEVARRDSAPTENR
LAKSDVPIQLLSATNQFQRQAAVQQQIPTKLAASTKGGKDKGGKSRGSQRWESSASFDLK
QQLLLNKLMGKDESTSRNRRSLSPILPGRHSPAPPPDPGFPAPSPPPADSPSEGFSLKAG
GTALLPGPPAPSPLPATPLSAKEDASKEDVIFF
GenBank ID Protein 195972857
UniProtKB/Swiss-Prot ID Q6ZSZ5
UniProtKB/Swiss-Prot Entry Name ARHGI_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001130955.1
GeneCard ID ARHGEF18
GenAtlas ID ARHGEF18
HGNC ID HGNC:17090
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  6. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  7. Nagase T, Ishikawa K, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Feb 28;5(1):31-9. [PubMed:9628581 ]
  8. Niu J, Profirovic J, Pan H, Vaiskunaite R, Voyno-Yasenetskaya T: G Protein betagamma subunits stimulate p114RhoGEF, a guanine nucleotide exchange factor for RhoA and Rac1: regulation of cell shape and reactive oxygen species production. Circ Res. 2003 Oct 31;93(9):848-56. Epub 2003 Sep 25. [PubMed:14512443 ]
  9. Blomquist A, Schworer G, Schablowski H, Psoma A, Lehnen M, Jakobs KH, Rumenapp U: Identification and characterization of a novel Rho-specific guanine nucleotide exchange factor. Biochem J. 2000 Dec 1;352 Pt 2:319-25. [PubMed:11085924 ]
  10. Acierno JS Jr, Kennedy JC, Falardeau JL, Leyne M, Bromley MC, Colman MW, Sun M, Bove C, Ashworth LK, Chadwick LH, Schiripo T, Ma S, Goldin E, Schiffmann R, Slaugenhaupt SA: A physical and transcript map of the MCOLN1 gene region on human chromosome 19p13.3-p13.2. Genomics. 2001 Apr 15;73(2):203-10. [PubMed:11318610 ]
  11. Nagata K, Inagaki M: Cytoskeletal modification of Rho guanine nucleotide exchange factor activity: identification of a Rho guanine nucleotide exchange factor as a binding partner for Sept9b, a mammalian septin. Oncogene. 2005 Jan 6;24(1):65-76. [PubMed:15558029 ]