You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11481
Secondary Accession Numbers
  • 17830
Name Rho guanine nucleotide exchange factor 7
Synonyms
  1. Beta-Pix
  2. COOL-1
  3. PAK-interacting exchange factor beta
  4. p85
Gene Name ARHGEF7
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function Acts as a RAC1 guanine nucleotide exchange factor (GEF) and can induce membrane ruffling. May function as a positive regulator of apoptosis. May function in cell migration
Pathways
  • Intracellular Signalling Through Adenosine Receptor A2a and Adenosine
  • Intracellular Signalling Through Adenosine Receptor A2b and Adenosine
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
intracellular signaling pathway
signaling
signaling pathway
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 13q34
SNPs ARHGEF7
Gene Sequence
>2412 bp
ATGAATTCCGCCGAGCAAACCGTTACGTGGCTCATCACTCTGGGGGTGCTGGAGTCGCCC
AAAAAAACCATCTCGGACCCGGAGGGCTTTCTGCAGGCGTCGCTGAAGGATGGGGTGGTC
CTCTGCAGGCTGCTGGAGCGCCTGCTCCCCGGGACCATCGAGAAAGTCTACCCCGAGCCC
CGGAGCGAGAGCGAGTGCCTGAGCAACATCCGCGAGTTCCTGCGCGGCTGCGGGGCTTCC
CTGCGGCTGGAGCTCCTGTTTCCTCCTTCCCAGCCTCCTCAGCATCTGGTAACCACCATT
CTCTTGTCTGCTTCTACGTTTGATGCAAATGATTTGTATCAGGGGCAGAATTTTAACAAG
GTCCTCAGTTCCTTAGTGACTCTAAATAAAGTAACAGCAGACATCGGGCTGGGGAGTGAC
TCCGTGTGTGCCCGGCCCTCGTCTCACCGCATAAAGTCTTTTGACTCCCTTGGATCACAG
TCTTTGCACACTCGGACTTCAAAACTGTTCCAGGGCCAGTATCGGAGTTTGGACATGACC
GATAATAGCAACAATCAACTGGTAGTAAGAGCAAAGTTTAACTTCCAGCAGACCAATGAG
GACGAGCTTTCCTTCTCAAAAGGAGACGTCATCCATGTCACCCGTGTGGAAGAGGGAGGC
TGGTGGGAGGGCACACTCAACGGCCGGACCGGCTGGTTCCCCAGCAACTACGTGCGCGAG
GTCAAGGCCAGCGAGAAGCCTGTGTCTCCCAAATCAGGAACACTGAAGAGCCCTCCCAAA
GGATTTGATACGACTGCCATAAACAAAAGCTATTACAATGTGGTGCTACAGAATATTTTA
GAAACAGAAAATGAATATTCTAAAGAACTTCAGACTGTGCTTTCAACGTACCTACGGCCA
TTGCAGACCAGTGAGAAGTTAAGTTCAGCAAACATTTCATATTTAATGGGAAATCTAGAA
GAAATATGTTCTTTCCAGCAAATGCTCGTACAGTCTTTAGAAGAATGCACCAAGTTGCCC
GAAGCTCAGCAGAGAGTCGGAGGCTGCTTTTTAAACCTGATGCCACAGATGAAAACCCTG
TACCTCACGTATTGTGCCAATCACCCTTCTGCAGTGAATGTCCTCACGGAACACAGTGAG
GAGTTGGGGGAGTTCATGGAGACCAAAGGTGCCAGCAGCCCTGGGATTCTCGTGCTGACC
ACGGGCCTGAGCAAACCCTTCATGCGCCTGGATAAATACCCTACGCTGCTCAAAGAGCTC
GAGAGACACATGGAGGATTATCATACAGATAGACAAGATATTCAAAAATCCATGGCTGCC
TTCAAAAACCTTTCAGCCCAATGTCAAGAAGTCCGGAAGAGGAAAGAGCTTGAGCTGCAG
ATCCTGACGGAAGCCATCCGGAACTGGGAGGGCGATGACATTAAAACTCTGGGCAACGTC
ACTTACATGTCCCAGGTCCTGATTCAGTGTGCCGGAAGTGAGGAAAAGAATGAAAGATAT
CTTCTACTCTTCCCAAATGTTTTGCTAATGTTGTCTGCCAGTCCTAGGATGAGTGGCTTT
ATCTATCAGGGAAAGCTTCCAACGACAGGAATGACAATCACAAAGCTTGAGGACAGTGAA
AATCATAGAAATGCATTTGAAATATCAGGGAGCATGATTGAGCGGATATTAGTGTCGTGC
AACAACCAGCAGGATCTGCAGGAATGGGTGGAGCACCTACAGAAGCAAACGAAGGTCACG
TCTGTGGGAAACCCCACCATAAAGCCTCATTCAGTGCCATCTCATACCCTCCCCTCCCAC
CCGGTCACTCCGTCCAGCAAGCACGCAGACAGCAAGCCCGCGCCGCTGACGCCCGCCTAC
CACACGCTGCCCCACCCCTCCCACCACGGCACCCCGCACACCACCATCAACTGGGGACCC
CTGGAGCCTCCGAAAACACCCAAGCCCTGGAGCCTGAGCTGCCTGCGGCCCGCGCCTCCC
CTCCGGCCCTCAGCTGCTCTCTGCTACAAGGAGGATCTTAGTAAGAGCCCTAAGACCATG
AAAAAGCTGCTGCCCAAGCGCAAACCTGAACGGAAGCCTTCAGATGAGGAGTTCGCGTCC
CGGAAAAGCACAGCTGCTTTGGAAGAAGATGCTCAGATTCTGAAAGTCATTGAAGCTTAC
TGCACCAGCGCCAAAACAAGGCAAACACTCAATTCAACATGGCAAGGCACTGACCTGATG
CATAATCACGTCTTGGCTGATGATGACCAACCAAGCCTAGACTCCCTGGGGCGTCGCAGT
AGCCTTTCTCGTTTGGAGCCTTCAGACCTCTCGGAAGACTCTGACTATGACAGTATATGG
ACAGCCCATAGTTACAGAATGGGTTCTACATCTCGTAAGAGCTGTTGCTCATATATCTCT
CACCAGAACTAA
Protein Properties
Number of Residues 803
Molecular Weight 90011.2
Theoretical pI 7.1
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rho guanine nucleotide exchange factor 7
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEP
RSESECLSNIREFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNK
VLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMT
DNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVRE
VKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRP
LQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTL
YLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKEL
ERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNV
TYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSE
NHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSH
PVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPP
LRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAY
CTSAKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDLSEDSDYDSIW
TAHSYRMGSTSRKSCCSYISHQN
GenBank ID Protein 166064034
UniProtKB/Swiss-Prot ID Q14155
UniProtKB/Swiss-Prot Entry Name ARHG7_HUMAN
PDB IDs
GenBank Gene ID NM_001113511.1
GeneCard ID ARHGEF7
GenAtlas ID ARHGEF7
HGNC ID HGNC:15607
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  6. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  7. Nagase T, Seki N, Tanaka A, Ishikawa K, Nomura N: Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 1995 Aug 31;2(4):167-74, 199-210. [PubMed:8590280 ]
  8. Ohira M, Morohashi A, Nakamura Y, Isogai E, Furuya K, Hamano S, Machida T, Aoyama M, Fukumura M, Miyazaki K, Suzuki Y, Sugano S, Hirato J, Nakagawara A: Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma. Cancer Lett. 2003 Jul 18;197(1-2):63-8. [PubMed:12880961 ]
  9. Nola S, Sebbagh M, Marchetto S, Osmani N, Nourry C, Audebert S, Navarro C, Rachel R, Montcouquiol M, Sans N, Etienne-Manneville S, Borg JP, Santoni MJ: Scrib regulates PAK activity during the cell migration process. Hum Mol Genet. 2008 Nov 15;17(22):3552-65. doi: 10.1093/hmg/ddn248. Epub 2008 Aug 20. [PubMed:18716323 ]
  10. Lee HW, Choi J, Shin H, Kim K, Yang J, Na M, Choi SY, Kang GB, Eom SH, Kim H, Kim E: Preso, a novel PSD-95-interacting FERM and PDZ domain protein that regulates dendritic spine morphogenesis. J Neurosci. 2008 Dec 31;28(53):14546-56. doi: 10.1523/JNEUROSCI.3112-08.2008. [PubMed:19118189 ]
  11. Mott HR, Nietlispach D, Evetts KA, Owen D: Structural analysis of the SH3 domain of beta-PIX and its interaction with alpha-p21 activated kinase (PAK). Biochemistry. 2005 Aug 23;44(33):10977-83. [PubMed:16101281 ]
  12. Homma K, Kikuno RF, Nagase T, Ohara O, Nishikawa K: Alternative splice variants encoding unstable protein domains exist in the human brain. J Mol Biol. 2004 Nov 5;343(5):1207-20. [PubMed:15491607 ]
  13. Bagrodia S, Taylor SJ, Jordon KA, Van Aelst L, Cerione RA: A novel regulator of p21-activated kinases. J Biol Chem. 1998 Sep 11;273(37):23633-6. [PubMed:9726964 ]
  14. Audebert S, Navarro C, Nourry C, Chasserot-Golaz S, Lecine P, Bellaiche Y, Dupont JL, Premont RT, Sempere C, Strub JM, Van Dorsselaer A, Vitale N, Borg JP: Mammalian Scribble forms a tight complex with the betaPIX exchange factor. Curr Biol. 2004 Jun 8;14(11):987-95. [PubMed:15182672 ]
  15. Zhan L, Rosenberg A, Bergami KC, Yu M, Xuan Z, Jaffe AB, Allred C, Muthuswamy SK: Deregulation of scribble promotes mammary tumorigenesis and reveals a role for cell polarity in carcinoma. Cell. 2008 Nov 28;135(5):865-78. doi: 10.1016/j.cell.2008.09.045. [PubMed:19041750 ]
  16. Aghazadeh B, Zhu K, Kubiseski TJ, Liu GA, Pawson T, Zheng Y, Rosen MK: Structure and mutagenesis of the Dbl homology domain. Nat Struct Biol. 1998 Dec;5(12):1098-107. [PubMed:9846881 ]