Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11496
Secondary Accession Numbers
  • 17850
Name GRB2-related adapter protein
Synonyms Not Available
Gene Name GRAP
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Couples signals from receptor and cytoplasmic tyrosine kinases to the Ras signaling pathway
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 17p11.2
SNPs GRAP
Gene Sequence
>654 bp
ATGGAGTCCGTGGCCCTGTACAGCTTTCAGGCTACAGAGAGCGACGAGCTGGCCTTCAAC
AAGGGAGACACACTCAAGATCCTGAACATGGAGGATGACCAGAACTGGTACAAGGCCGAG
CTCCGGGGTGTCGAGGGATTTATTCCCAAGAACTACATCCGCGTCAAGCCCCATCCGTGG
TACTCGGGCAGGATTTCCCGGCAGCTGGCCGAAGAGATTCTGATGAAGCGGAACCATCTG
GGAGCCTTCCTGATCCGGGAGAGTGAGAGCTCCCCAGGGGAGTTCTCTGTGTCTGTGAAC
TATGGAGACCAGGTGCAGCACTTCAAGGTGCTGCGTGAGGCCTCGGGGAAGTACTTCCTG
TGGGAGGAGAAGTTCAACTCCCTCAACGAGCTGGTCGACTTCTACCGCACCACCACCATC
GCCAAGAAGCGGCAGATCTTCCTGCGCGACGAGGAGCCCTTGCTCAAGTCACCTGGGGCC
TGCTTTGCCCAGGCCCAGTTTGACTTCTCAGCCCAGGACCCCTCGCAGCTCAGCTTCCGC
CGTGGCGACATCATTGAGGTCCTGGAGCGCCCAGACCCCCACTGGTGGCGGGGCCGGTCC
TGCGGGCGCGTTGGCTTCTTCCCACGGAGTTACGTGCAGCCCGTGCACCTGTGA
Protein Properties
Number of Residues 217
Molecular Weight 25336.4
Theoretical pI 7.06
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>GRB2-related adapter protein
MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPW
YSGRISRQLAEEILMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFL
WEEKFNSLNELVDFYRTTTIAKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFR
RGDIIEVLERPDPHWWRGRSCGRVGFFPRSYVQPVHL
GenBank ID Protein 5729856
UniProtKB/Swiss-Prot ID Q13588
UniProtKB/Swiss-Prot Entry Name GRAP_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_006613.3
GeneCard ID GRAP
GenAtlas ID GRAP
HGNC ID HGNC:4562
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  3. Zhang W, Sloan-Lancaster J, Kitchen J, Trible RP, Samelson LE: LAT: the ZAP-70 tyrosine kinase substrate that links T cell receptor to cellular activation. Cell. 1998 Jan 9;92(1):83-92. [PubMed:9489702 ]
  4. Welsh M, Songyang Z, Frantz JD, Trub T, Reedquist KA, Karlsson T, Miyazaki M, Cantley LC, Band H, Shoelson SE: Stimulation through the T cell receptor leads to interactions between SHB and several signaling proteins. Oncogene. 1998 Feb 19;16(7):891-901. [PubMed:9484780 ]
  5. Feng GS, Ouyang YB, Hu DP, Shi ZQ, Gentz R, Ni J: Grap is a novel SH3-SH2-SH3 adaptor protein that couples tyrosine kinases to the Ras pathway. J Biol Chem. 1996 May 24;271(21):12129-32. [PubMed:8647802 ]