You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11512
Secondary Accession Numbers
  • 17866
Name Rho guanine nucleotide exchange factor 3
Synonyms
  1. Exchange factor found in platelets and leukemic and neuronal tissues
  2. XPLN
Gene Name ARHGEF3
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function Acts as guanine nucleotide exchange factor (GEF) for RhoA and RhoB GTPases
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
intracellular signaling pathway
signaling
signaling pathway
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:3
Locus 3p21-p13
SNPs ARHGEF3
Gene Sequence
>1581 bp
ATGGTGGCCAAGGATTACCCCTTCTACCTCACGGTCAAGAGAGCGAACTGCAGCCTGGAG
CTACCCCCGGCCAGCGGTCCGGCCAAGGACGCTGAGGAGCCTAGTAATAAACGGGTCAAA
CCCCTTTCCCGAGTCACGTCGCTAGCAAACCTCATCCCGCCCGTGAAGGCCACGCCATTA
AAGCGCTTCAGTCAAACCCTGCAGCGCTCCATTAGCTTCCGCAGTGAGAGCCGCCCTGAC
ATCCTCGCCCCCCGACCCTGGTCCAGAAATGCCGCCCCCTCGAGCACGAAACGGAGAGAT
AGCAAGCTGTGGAGTGAGACCTTCGATGTGTGCGTCAATCAGATGCTTACATCCAAGGAA
ATCAAACGTCAGGAGGCGATCTTTGAGCTTTCCCAAGGAGAAGAAGACTTGATAGAAGAC
TTGAAATTAGCAAAAAAGGCCTATCATGACCCCATGCTGAAACTCTCCATAATGACAGAA
CAAGAGTTGAATCAAATTTTTGGAACACTGGACTCTCTAATTCCTCTACATGAAGAGCTC
CTTAGTCAGCTTCGAGATGTTAGGAAGCCTGATGGCTCGACTGAACATGTTGGTCCCATC
CTCGTGGGCTGGCTCCCTTGCCTCAGCTCCTATGATAGCTACTGCAGCAATCAAGTAGCC
GCCAAAGCTCTGCTGGACCACAAAAAGCAAGATCACCGAGTCCAGGATTTCCTACAGCGA
TGTTTAGAATCCCCCTTTAGCCGCAAACTAGATCTCTGGAATTTCCTCGATATTCCAAGA
AGCCGCCTGGTAAAATACCCTCTGCTTCTCCGAGAAATCTTGAGGCACACACCAAATGAT
AATCCAGATCAGCAGCACTTGGAAGAAGCTATAAATATCATTCAGGGAATTGTGGCAGAA
ATCAACACCAAGACTGGTGAATCTGAATGCCGCTATTATAAAGAGCGGCTTCTTTACTTG
GAAGAAGGCCAGAAAGACTCCCTGATCGACAGCTCTCGAGTCTTGTGTTGTCATGGTGAA
CTGAAGAACAATCGGGGCGTGAAACTGCATGTTTTCCTGTTCCAAGAAGTGCTTGTGATC
ACTCGAGCCGTCACCCACAATGAGCAGCTTTGCTACCAGCTGTACCGTCAGCCAATCCCC
GTGAAAGACCTCCTGCTGGAAGACCTCCAGGATGGAGAAGTGAGGCTGGGTGGCTCCCTG
CGAGGGGCATTCAGCAACAATGAGAGAATTAAAAACTTCTTCAGAGTCAGTTTCAAAAAT
GGATCCCAAAGTCAGACCCACTCGCTACAAGCCAATGACACTTTCAACAAACAGCAGTGG
CTTAACTGTATTCGTCAAGCCAAAGAAACAGTTTTGTGTGCTGCCGGGCAAGCTGGGGTG
CTTGACTCCGAGGGATCGTTCCTAAATCCCACCACCGGGAGCAGAGAGCTACAGGGAGAA
ACAAAACTTGAGCAGATGGACCAATCGGACAGTGAGTCAGACTGTAGTATGGACACGAGT
GAGGTCAGCCTCGACTGTGAGCGCATGGAACAGACAGACTCTTCCTGTGGAAACAGCAGG
CACGGTGAAAGTAACGTCTGA
Protein Properties
Number of Residues 526
Molecular Weight 59782.1
Theoretical pI 6.38
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rho guanine nucleotide exchange factor 3
MVAKDYPFYLTVKRANCSLELPPASGPAKDAEEPSNKRVKPLSRVTSLANLIPPVKATPL
KRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKE
IKRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEEL
LSQLRDVRKPDGSTEHVGPILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDHRVQDFLQR
CLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAINIIQGIVAE
INTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGVKLHVFLFQEVLVI
TRAVTHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFFRVSFKN
GSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGE
TKLEQMDQSDSESDCSMDTSEVSLDCERMEQTDSSCGNSRHGESNV
GenBank ID Protein 9506401
UniProtKB/Swiss-Prot ID Q9NR81
UniProtKB/Swiss-Prot Entry Name ARHG3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_019555.2
GeneCard ID ARHGEF3
GenAtlas ID ARHGEF3
HGNC ID HGNC:683
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  4. Arthur WT, Ellerbroek SM, Der CJ, Burridge K, Wennerberg K: XPLN, a guanine nucleotide exchange factor for RhoA and RhoB, but not RhoC. J Biol Chem. 2002 Nov 8;277(45):42964-72. Epub 2002 Sep 6. [PubMed:12221096 ]
  5. Thiesen S, Kubart S, Ropers HH, Nothwang HG: Isolation of two novel human RhoGEFs, ARHGEF3 and ARHGEF4, in 3p13-21 and 2q22. Biochem Biophys Res Commun. 2000 Jun 24;273(1):364-9. [PubMed:10873612 ]