Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11558
Secondary Accession Numbers
  • 21002
Name Sphingosine-1-phosphate phosphatase 2
Synonyms
  1. SPPase2
  2. Sphingosine-1-phosphatase 2
  3. Spp2
  4. hSPP2
Gene Name SGPP2
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Has specific phosphohydrolase activity towards sphingoid base 1-phosphates. Has high phosphohydrolase activity against dihydrosphingosine-1-phosphate and sphingosine-1-phosphate (S1P) in vitro. May play a role in attenuating intracellular sphingosine 1-phosphate (S1P) signaling. May play a role in pro-inflammatory signaling.
Pathways
  • Fabry disease
  • Gaucher Disease
  • Globoid Cell Leukodystrophy
  • Krabbe disease
  • Metachromatic Leukodystrophy (MLD)
  • Sphingolipid Metabolism
  • sphingolipid metabolism
Reactions
Sphinganine 1-phosphate + Water → Sphinganine + Phosphoric acid details
GO Classification
Biological Process
phospholipid metabolic process
sphingolipid biosynthetic process
sphingosine metabolic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Component
membrane
cell part
Function
catalytic activity
Molecular Function
sphingosine-1-phosphate phosphatase activity
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs SGPP2
Gene Sequence
>1200 bp
ATGGCCGAGCTGCTGCGGAGCCTGCAGGATTCCCAGCTCGTCGCCCGCTTCCAGCGCCGC
TGCGGGCTCTTCCCCGCTCCGGATGAAGGCCCCCGGGAGAACGGCGCGGACCCCACGGAG
CGCGCGGCGCGGGTCCCCGGGGTCGAGCATCTCCCCGCAGCCAACGGCAAGGGCGGCGAG
GCTCCGGCCAACGGGCTGCGCAGAGCCGCGGCGCCGGAGGCTTATGTACAGAAGTACGTC
GTGAAGAATTATTTCTACTATTACCTATTCCAATTTTCAGCTGCTTTGGGCCAAGAAGTG
TTCTACATCACGTTTCTTCCATTCACTCACTGGAATATTGACCCTTATTTATCCAGAAGA
TTGATCATCATATGGGTTTTGGTGATGTATATTGGCCAAGTGGCCAAGGATGTCTTGAAG
TGGCCCCGTCCCTCCTCCCCTCCAGTTGTAAAACTGGAAAAGAGACTGATCGCTGAATAT
GGAATGCCATCCACCCACGCCATGGCGGCCACTGCCATTGCCTTCACCCTCCTTATCTCT
ACTATGGACAGATACCAGTATCCATTTGTGTTGGGACTGGTGATGGCCGTGGTGTTTTCC
ACCTTGGTGTGTCTCAGCAGGCTCTACACTGGGATGCATACGGTCCTGGATGTGCTGGGT
GGCGTCCTGATCACCGCACTCCTCATCGTCCTCACCTACCCTGCCTGGACCTTCATCGAC
TGCCTGGACTCGGCCAGCCCCCTCTTCCCCGTGTGTGTCATAGTTGTGCCATTCTTCCTG
TGTTACAATTACCCTGTTTCTGATTACTACAGCCCAACCCGGGCGGACACCACCACCATT
CTGGCTGCCGGGGCTGGAGTGACCATAGGATTCTGGATCAACCATTTCTTCCAGCTTGTA
TCCAAGCCCGCTGAATCTCTCCCTGTTATTCAGAACATCCCACCACTCACCACCTACATG
TTAGTTTTGGGTCTGACCAAATTTGCAGTGGGAATTGTGTTGATCCTCTTGGTTCGTCAG
CTTGTACAAAATCTCTCACTGCAAGTATTATACTCATGGTTCAAGGTGGTCACCAGGAAC
AAGGAGGCCAGGCGGAGACTGGAGATTGAAGTGCCTTACAAGTTTGTTACCTACACATCT
GTTGGCATCTGCGCTACAACCTTTGTGCCGATGCTTCACAGGTTTCTGGGATTACCCTGA
Protein Properties
Number of Residues 399
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sphingosine-1-phosphate phosphatase 2
MAELLRSLQDSQLVARFQRRCGLFPAPDEGPRENGADPTERAARVPGVEHLPAANGKGGE
APANGLRRAAAPEAYVQKYVVKNYFYYYLFQFSAALGQEVFYITFLPFTHWNIDPYLSRR
LIIIWVLVMYIGQVAKDVLKWPRPSSPPVVKLEKRLIAEYGMPSTHAMAATAIAFTLLIS
TMDRYQYPFVLGLVMAVVFSTLVCLSRLYTGMHTVLDVLGGVLITALLIVLTYPAWTFID
CLDSASPLFPVCVIVVPFFLCYNYPVSDYYSPTRADTTTILAAGAGVTIGFWINHFFQLV
SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVLYSWFKVVTRN
KEARRRLEIEVPYKFVTYTSVGICATTFVPMLHRFLGLP
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8IWX5
UniProtKB/Swiss-Prot Entry Name SGPP2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF542512
GeneCard ID SGPP2
GenAtlas ID SGPP2
HGNC ID HGNC:19953
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Ogawa C, Kihara A, Gokoh M, Igarashi Y: Identification and characterization of a novel human sphingosine-1-phosphate phosphohydrolase, hSPP2. J Biol Chem. 2003 Jan 10;278(2):1268-72. Epub 2002 Oct 30. [PubMed:12411432 ]
  4. Mechtcheriakova D, Wlachos A, Sobanov J, Kopp T, Reuschel R, Bornancin F, Cai R, Zemann B, Urtz N, Stingl G, Zlabinger G, Woisetschlager M, Baumruker T, Billich A: Sphingosine 1-phosphate phosphatase 2 is induced during inflammatory responses. Cell Signal. 2007 Apr;19(4):748-60. Epub 2006 Sep 30. [PubMed:17113265 ]