You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11568
Secondary Accession Numbers
  • 21012
Name Ig lambda-1 chain C regions
Synonyms Not Available
Gene Name IGLC1
Protein Type Enzyme
Biological Properties
General Function Involved in antigen binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 22q11.2
SNPs IGLC1
Gene Sequence
>320 bp
GTCAGCCCAAGGCCAACCCCACTGTCACTCTGTTCCCGCCCTCCTCTGAGGAGCTCCAAG
CCAACAAGGCCACACTAGTGTGTCTGATCAGTGACTTCTACCCGGGAGCTGTGACAGTGG
CCTGGAAGGCAGATGGCAGCCCCGTCAAGGCGGGAGTGGAGACCACCAAACCCTCCAAAC
AGAGCAACAACAAGTACGCGGCCAGCAGCTACCTGAGCCTGACGCCCGAGCAGTGGAAGT
CCCACAGAAGCTACAGCTGCCAGGTCACGCATGAAGGGAGCACCGTGGAGAAGACAGTGG
CCCCTACAGAATGTTCATAG
Protein Properties
Number of Residues 106
Molecular Weight 11347.6
Theoretical pI 8.05
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ig lambda-1 chain C regions
GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSK
QSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
GenBank ID Protein 1335154
UniProtKB/Swiss-Prot ID P0CG04
UniProtKB/Swiss-Prot Entry Name LAC1_HUMAN
PDB IDs
GenBank Gene ID X51755
GeneCard ID IGLC1
GenAtlas ID IGLC1
HGNC ID HGNC:5855
References
General References
  1. Fett JW, Deutsch HF: Primary structure of the Mcg lambda chain. Biochemistry. 1974 Sep 24;13(20):4102-14. [PubMed:4415202 ]
  2. Ely KR, Herron JN, Harker M, Edmundson AB: Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms. J Mol Biol. 1989 Dec 5;210(3):601-15. [PubMed:2515285 ]
  3. Vasicek TJ, Leder P: Structure and expression of the human immunoglobulin lambda genes. J Exp Med. 1990 Aug 1;172(2):609-20. [PubMed:2115572 ]
  4. Hieter PA, Hollis GF, Korsmeyer SJ, Waldmann TA, Leder P: Clustered arrangement of immunoglobulin lambda constant region genes in man. Nature. 1981 Dec 10;294(5841):536-40. [PubMed:6273747 ]