You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11582
Secondary Accession Numbers
  • 21026
Name Casein kinase I isoform gamma-2
Synonyms
  1. CKI-gamma 2
Gene Name CSNK1G2
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.3
SNPs CSNK1G2
Gene Sequence
>1248 bp
ATGGATTTTGACAAGAAAGGAGGGAAAGGGGAGACGGAGGAGGGCCGGAGAATGTCCAAG
GCCGGCGGGGGCCGGAGCAGCCACGGCATCCGGAGCTCGGGGACCAGCTCGGGGGTCCTG
ATGGTGGGCCCCAACTTCCGCGTCGGCAAGAAGATCGGCTGCGGCAACTTCGGGGAGCTC
CGCCTAGGAAAGAATCTCTATACAAATGAATACGTGGCTATCAAATTGGAGCCGATCAAG
TCCCGGGCCCCGCAGCTGCACCTGGAGTACCGGTTCTACAAGCAGCTCAGCGCCACAGAG
GGCGTCCCTCAGGTCTACTACTTCGGTCCGTGCGGGAAGTACAACGCCATGGTGCTGGAG
CTGCTGGGGCCCAGCCTGGAGGACCTGTTCGACCTGTGCGACCGGACCTTCACGCTCAAG
ACGGTGCTGATGATCGCCATCCAGCTGATCACGCGCATGGAGTATGTGCACACCAAGAGC
CTAATCTACCGGGACGTGAAGCCCGAGAACTTCCTGGTGGGCCGCCCGGGGACCAAGCGG
CAGCATGCCATCCACATCATCGACTTCGGGCTGGCCAAGGAGTACATCGACCCCGAGACC
AAGAAGCACATCCCGTACCGCGAGCACAAGAGCCTGACGGGCACGGCGCGCTACATGAGC
ATCAACACGCACCTGGGCAAGGAGCAGAGCCGCCGCGACGACCTGGAGGCGCTGGGCCAC
ATGTTCATGTACTTCCTGCGCGGCAGCCTTCCCTGGCAGGGGCTCAAGGCCGACACGCTC
AAGGAGCGGTACCAGAAGATCGGGGACACCAAACGCGCCACGCCCATCGAGGTGCTCTGC
GAGAACTTCCCAGAGGAGATGGCCACGTACCTGCGCTATGTGCGGCGCCTGGACTTCTTC
GAGAAGCCCGACTATGACTACCTGCGGAAGCTCTTCACCGACCTCTTCGACCGCAGTGGC
TTCGTGTTCGACTATGAGTACGACTGGGCCGGGAAGCCCCTGCCGACCCCCATCGGCACC
GTCCACACCGACCTGCCCTCCCAGCCTCAGCTCCGGGACAAAACCCAGCCGCACAGCAAA
AACCAGGCGTTGAACTCCACCAACGGGGAGCTGAATGCGGACGACCCCACGGCCGGCCAC
TCCAACGCCCCGATCACAGCGCCTGCAGAGGTGGAGGTGGCCGATGAAACCAAATGCTGC
TGTTTCTTCAAGAGGAGAAAGAGAAAATCGCTGCAGCGACACAAGTAA
Protein Properties
Number of Residues 415
Molecular Weight 47456.9
Theoretical pI 9.42
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Casein kinase I isoform gamma-2
MDFDKKGGKGETEEGRRMSKAGGGRSSHGIRSSGTSSGVLMVGPNFRVGKKIGCGNFGEL
RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVYYFGPCGKYNAMVLE
LLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKR
QHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGH
MFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFF
EKPDYDYLRKLFTDLFDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQLRDKTQPHSK
NQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKRKSLQRHK
GenBank ID Protein 197692257
UniProtKB/Swiss-Prot ID P78368
UniProtKB/Swiss-Prot Entry Name KC1G2_HUMAN
PDB IDs Not Available
GenBank Gene ID AB451278
GeneCard ID CSNK1G2
GenAtlas ID CSNK1G2
HGNC ID HGNC:2455
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  5. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. [PubMed:19054851 ]
  6. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  7. Kitabayashi AN, Kusuda J, Hirai M, Hashimoto K: Cloning and chromosomal mapping of human casein kinase I gamma 2 (CSNK1G2). Genomics. 1997 Nov 15;46(1):133-7. [PubMed:9403068 ]