Showing Protein Probable DNA dC->dU-editing enzyme APOBEC-3D (HMDBP11594)
Identification | ||||||||
---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11594 | |||||||
Secondary Accession Numbers | None | |||||||
Name | Probable DNA dC->dU-editing enzyme APOBEC-3D | |||||||
Synonyms | Not Available | |||||||
Gene Name | APOBEC3D | |||||||
Protein Type | Unknown | |||||||
Biological Properties | ||||||||
General Function | Not Available | |||||||
Specific Function | Probable DNA cytidine deaminase involved in foreign DNA clearance. May provide cellular innate resistance to a specific panel of genetic invaders including endogenous retroelements and a subset of viruses. | |||||||
Pathways | Not Available | |||||||
Reactions |
|
|||||||
GO Classification |
|
|||||||
Cellular Location | Not Available | |||||||
Gene Properties | ||||||||
Chromosome Location | 22 | |||||||
Locus | 22q13.1 | |||||||
SNPs | Not Available | |||||||
Gene Sequence | Not Available | |||||||
Protein Properties | ||||||||
Number of Residues | Not Available | |||||||
Molecular Weight | 46598.035 | |||||||
Theoretical pI | 8.394 | |||||||
Pfam Domain Function | Not Available | |||||||
Signals | Not Available | |||||||
Transmembrane Regions | Not Available | |||||||
Protein Sequence |
>>gi|187608816|ref|NP_689639.2| DNA dC->dU-editing enzyme APOBEC-3D [Homo sapiens] MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGPVL PKRQSNHRQE |
|||||||
External Links | ||||||||
GenBank ID Protein | Not Available | |||||||
UniProtKB/Swiss-Prot ID | Q96AK3 | |||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||
PDB IDs | Not Available | |||||||
GenBank Gene ID | Not Available | |||||||
GeneCard ID | Not Available | |||||||
GenAtlas ID | Not Available | |||||||
HGNC ID | HGNC:17354 | |||||||
References | ||||||||
General References | Not Available |