You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11598
Secondary Accession Numbers None
Name 1-acylglycerol-3-phosphate O-acyltransferase ABHD5
Synonyms
  1. Abhydrolase domain-containing protein 5
  2. Lipid droplet-binding protein CGI-58
Gene Name ABHD5
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Lysophosphatidic acid acyltransferase which functions in phosphatidic acid biosynthesis. May regulate the cellular storage of triacylglycerol through activation of the phospholipase PNPLA2. Involved in keratinocyte differentiation.
Pathways Not Available
Reactions
Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate → Coenzyme A + 1,2-diacyl-sn-glycerol 3-phosphate details
Acyl-[acyl-carrier protein] + 1-Acyl-sn-glycerol 3-phosphate → Acyl-carrier protein + Phosphatidate details
GO Classification
Biological Process
small molecule metabolic process
positive regulation of triglyceride catabolic process
fatty acid metabolic process
cell differentiation
negative regulation of sequestering of triglyceride
phosphatidic acid biosynthetic process
positive regulation of lipoprotein lipase activity
triglyceride catabolic process
Cellular Component
cytosol
lipid particle
Molecular Function
1-acylglycerol-3-phosphate O-acyltransferase activity
lysophosphatidic acid acyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus 3p21
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 39095.34
Theoretical pI 6.615
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|31542303|ref|NP_057090.2| 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 [Homo sapiens]
MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNG
NKIWTLKFSH
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8WTS1
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:21396
References
General References Not Available