You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11600
Secondary Accession Numbers None
Name Mycophenolic acid acyl-glucuronide esterase, mitochondrial
Synonyms
  1. Alpha/beta hydrolase domain-containing protein 10
  2. Abhydrolase domain-containing protein 10
Gene Name ABHD10
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Catalyzes the deglucuronidation of mycophenolic acid acyl-glucuronide, a metabolite of the immunosuppressant drug mycophenolate.
Pathways Not Available
Reactions
Mycophenolic acid O-acyl-glucuronide + Water → Mycophenolic acid + D-Glucuronic acid details
GO Classification
Biological Process
glucuronoside catabolic process
proteolysis
Cellular Component
cytosol
mitochondrion
Molecular Function
hydrolase activity, hydrolyzing O-glycosyl compounds
serine-type peptidase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus 3q13.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 33932.165
Theoretical pI 8.578
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|8923001|ref|NP_060864.1| mycophenolic acid acyl-glucuronide esterase, mitochondrial isoform 1 precursor [Homo sapiens]
MAVARLAAVAAWVPCRSWGWAAVPFGPHRGLSVLLARIPQRAPRWLPACRQKTSLSFLNR
PDLPNLAYKK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NUJ1
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:25656
References
General References Not Available