You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11604
Secondary Accession Numbers None
Name Hydroxylysine kinase
Synonyms
  1. 5-hydroxy-L-lysine kinase
  2. Aminoglycoside phosphotransferase domain-containing protein 1
Gene Name AGPHD1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Catalyzes the GTP-dependent phosphorylation of 5-hydroxy-L-lysine.
Pathways Not Available
Reactions
Guanosine triphosphate + 5-Hydroxylysine → Guanosine diphosphate + 5-phosphonooxy-L-lysine details
GO Classification
Cellular Component
cytoplasm
Molecular Function
hydroxylysine kinase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 15
Locus 15q25.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 41932.82
Theoretical pI 6.843
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|134288871|ref|NP_001013641.2| hydroxylysine kinase isoform 1 [Homo sapiens]
MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPT
EYVLKISNTK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID A2RU49
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:34403
References
General References Not Available