You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Hydroxylysine kinase (HMDBP11604)
Identification | |||||
---|---|---|---|---|---|
HMDB Protein ID | HMDBP11604 | ||||
Secondary Accession Numbers | None | ||||
Name | Hydroxylysine kinase | ||||
Synonyms |
|
||||
Gene Name | AGPHD1 | ||||
Protein Type | Unknown | ||||
Biological Properties | |||||
General Function | Not Available | ||||
Specific Function | Catalyzes the GTP-dependent phosphorylation of 5-hydroxy-L-lysine. | ||||
Pathways | Not Available | ||||
Reactions |
|
||||
GO Classification |
|
||||
Cellular Location | Not Available | ||||
Gene Properties | |||||
Chromosome Location | 15 | ||||
Locus | 15q25.1 | ||||
SNPs | Not Available | ||||
Gene Sequence | Not Available | ||||
Protein Properties | |||||
Number of Residues | Not Available | ||||
Molecular Weight | 41932.82 | ||||
Theoretical pI | 6.843 | ||||
Pfam Domain Function | Not Available | ||||
Signals | Not Available | ||||
Transmembrane Regions | Not Available | ||||
Protein Sequence |
>>gi|134288871|ref|NP_001013641.2| hydroxylysine kinase isoform 1 [Homo sapiens] MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPT EYVLKISNTK |
||||
External Links | |||||
GenBank ID Protein | Not Available | ||||
UniProtKB/Swiss-Prot ID | A2RU49 | ||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||
PDB IDs | Not Available | ||||
GenBank Gene ID | Not Available | ||||
GeneCard ID | Not Available | ||||
GenAtlas ID | Not Available | ||||
HGNC ID | HGNC:34403 | ||||
References | |||||
General References | Not Available |