You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11609
Secondary Accession Numbers None
Name Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase
Synonyms
  1. Asparagine-linked glycosylation protein 12 homolog
  2. Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase
  3. Mannosyltransferase ALG12 homolog
  4. Membrane protein SB87
  5. hALG12
Gene Name ALG12
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Adds the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation.
Pathways
  • N-Glycan biosynthesis
  • protein glycosylation
Reactions
Dolichyl phosphate D-mannose + D-Man-alpha-(1->2)-D-Man-alpha-(1->2)-D-Man-alpha-(1->3)-(D-Man-alpha-(1->2)-D-Man-alpha-(1->3)-D-Man-alpha-(1->6))-D-Man-beta-(1->4)-D-GlcNAc-beta-(1->4)-D-GlcNAc-diphosphodolichol → D-Man-alpha-(1->2)-D-Man-alpha-(1->2)-D-Man-alpha-(1->3)-(D-Man-alpha-(1->2)-D-Man-alpha-(1->3)-(D-Man-alpha-(1->6))-D-Man-alpha-(1->6))-D-Man-beta-(1->4)-D-GlcNAc-beta-(1->4)-D-GlcNAc-diphosphodolichol + Dolichol-20 details
Dolichyl phosphate D-mannose + → Dolichyl phosphate + details
GO Classification
Biological Process
GPI anchor biosynthetic process
protein folding
dolichol-linked oligosaccharide biosynthetic process
post-translational protein modification
protein N-linked glycosylation via asparagine
Cellular Component
endoplasmic reticulum membrane
intrinsic to endoplasmic reticulum membrane
integral to membrane
Molecular Function
alpha-1,6-mannosyltransferase activity
dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 22
Locus 22q13.33
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 54654.195
Theoretical pI 9.586
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|13129114|ref|NP_077010.1| dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase [Homo sapiens]
MAGKGSSGRRPLLLGLLVAVATVHLVICPYTKVEESFNLQATHDLLYHWQDLEQYDHLEF
PGVVPRTFLG
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9BV10
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:19358
References
General References Not Available