Hmdb loader
Survey
Identification
HMDB Protein ID HMDBP11611
Secondary Accession Numbers None
Name Alkylated DNA repair protein alkB homolog 1
Synonyms
  1. Alpha-ketoglutarate-dependent dioxygenase ABH1
  2. DNA lyase ABH1
  3. DNA oxidative demethylase ALKBH1
Gene Name ALKBH1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Dioxygenase that repairs alkylated single-stranded DNA and RNA containing 3-methylcytosine by oxidative demethylation. Requires molecular oxygen, alpha-ketoglutarate and iron. May have a role in placental trophoblast lineage differentiation (By similarity). Has DNA lyase activity and introduces double-stranded breaks at abasic sites. Cleaves both single-stranded DNA and double-stranded DNA at abasic sites, with the greatest activity towards double-stranded DNA with two abasic sites. DNA lyase activity does not require alpha-ketoglutarate and iron.
Pathways Not Available
Reactions
DNA-base-CH(3) + Oxoglutaric acid + Oxygen → DNA-base + Formaldehyde + Succinic acid + CO(2) details
GO Classification
Biological Process
developmental growth
DNA dealkylation involved in DNA repair
in utero embryonic development
neuron migration
neuron projection development
oxidative demethylation
RNA repair
DNA demethylation
placenta development
Cellular Component
mitochondrion
nuclear euchromatin
Molecular Function
ferrous iron binding
chemoattractant activity
DNA-(apurinic or apyrimidinic site) lyase activity
methylcytosine dioxygenase activity
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
Cellular Location Not Available
Gene Properties
Chromosome Location 14
Locus 14q24.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 43831.39
Theoretical pI 7.077
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|87298840|ref|NP_006011.2| alkylated DNA repair protein alkB homolog 1 [Homo sapiens]
MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQ
KVIKSQLNVS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q13686
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17911
References
General References Not Available