You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification |
HMDB Protein ID
| HMDBP11612 |
Secondary Accession Numbers
| None |
Name
| Alkylated DNA repair protein alkB homolog 8 |
Synonyms
|
- Probable alpha-ketoglutarate-dependent dioxygenase ABH8
- S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8
- tRNA (carboxymethyluridine(34)-5-O)-methyltransferase ABH8
|
Gene Name
| ALKBH8 |
Protein Type
| Unknown |
Biological Properties |
General Function
| Not Available |
Specific Function
| Catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA. Catalyzes the last step in the formation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA. Has a preference for tRNA(Arg) and tRNA(Glu), and does not bind tRNA(Lys). Required for normal survival after DNA damage. May inhibit apoptosis and promote cell survival and angiogenesis.
|
Pathways
|
Not Available
|
Reactions
|
S-Adenosylmethionine + carboxymethyluridine(34) in tRNA → S-Adenosylhomocysteine + 5-(2-methoxy-2-oxoethyl)uridine(34) in tRNA |
details
|
|
GO Classification
|
Biological Process |
response to DNA damage stimulus |
Cellular Component |
cytosol |
microtubule cytoskeleton |
nucleus |
Molecular Function |
metal ion binding |
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors |
tRNA (uracil) methyltransferase activity |
RNA binding |
|
Cellular Location
|
Not Available
|
Gene Properties |
Chromosome Location
| 11 |
Locus
| 11q22.3 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 75207.875 |
Theoretical pI
| 7.987 |
Pfam Domain Function
|
|
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>>gi|195927056|ref|NP_620130.2| alkylated DNA repair protein alkB homolog 8 [Homo sapiens]
MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANGGLGNGVSRNQ
LLPVLEKCGL
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| Q96BT7 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
|
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:25189 |
References |
General References
| Not Available |