You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11614
Secondary Accession Numbers None
Name Protein arginine N-methyltransferase 1
Synonyms
  1. Histone-arginine N-methyltransferase PRMT1
  2. Interferon receptor 1-bound protein 4
Gene Name PRMT1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Arginine methyltransferase that methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in proteins such as ESR1, histone H2, H3 and H4, PIAS1, HNRNPA1, HNRNPD, NFATC2IP, SUPT5H, TAF15 and EWS. Constitutes the main enzyme that mediates monomethylation and asymmetric dimethylation of histone H4 'Arg-4' (H4R3me1 and H4R3me2a, respectively), a specific tag for epigenetic transcriptional activation. Together with dimethylated PIAS1, represses STAT1 transcriptional activity, in the late phase of interferon gamma (IFN-gamma) signaling. May be involved in the regulation of TAF15 transcriptional activity, act as an activator of estrogen receptor (ER)-mediated transactivation, play a key role in neurite outgrowth and act as a negative regulator of megakaryocytic differentiation, by modulating p38 MAPK pathway. Methylates FOXO1 and retains it in the nucleus increasing its transcriptional acivity.
Pathways Not Available
Reactions
S-Adenosylmethionine + arginine-[histone] → S-Adenosylhomocysteine + N(omega)-methyl-arginine-[histone] details
GO Classification
Biological Process
in utero embryonic development
neuron projection development
cell surface receptor signaling pathway
negative regulation of megakaryocyte differentiation
Cellular Component
cytosol
cytoplasm
nucleus
nucleoplasm
Molecular Function
histone methyltransferase activity (H4-R3 specific)
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19q13.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 42461.28
Theoretical pI 5.346
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|154759421|ref|NP_001527.3| protein arginine N-methyltransferase 1 isoform 1 [Homo sapiens]
MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHF
GIHEEMLKDE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q99873
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:5187
References
General References Not Available