You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification |
HMDB Protein ID
| HMDBP11614 |
Secondary Accession Numbers
| None |
Name
| Protein arginine N-methyltransferase 1 |
Synonyms
|
- Histone-arginine N-methyltransferase PRMT1
- Interferon receptor 1-bound protein 4
|
Gene Name
| PRMT1 |
Protein Type
| Unknown |
Biological Properties |
General Function
| Not Available |
Specific Function
| Arginine methyltransferase that methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in proteins such as ESR1, histone H2, H3 and H4, PIAS1, HNRNPA1, HNRNPD, NFATC2IP, SUPT5H, TAF15 and EWS. Constitutes the main enzyme that mediates monomethylation and asymmetric dimethylation of histone H4 'Arg-4' (H4R3me1 and H4R3me2a, respectively), a specific tag for epigenetic transcriptional activation. Together with dimethylated PIAS1, represses STAT1 transcriptional activity, in the late phase of interferon gamma (IFN-gamma) signaling. May be involved in the regulation of TAF15 transcriptional activity, act as an activator of estrogen receptor (ER)-mediated transactivation, play a key role in neurite outgrowth and act as a negative regulator of megakaryocytic differentiation, by modulating p38 MAPK pathway. Methylates FOXO1 and retains it in the nucleus increasing its transcriptional acivity.
|
Pathways
|
Not Available
|
Reactions
|
S-Adenosylmethionine + arginine-[histone] → S-Adenosylhomocysteine + N(omega)-methyl-arginine-[histone] |
details
|
|
GO Classification
|
Biological Process |
in utero embryonic development |
neuron projection development |
cell surface receptor signaling pathway |
negative regulation of megakaryocyte differentiation |
Cellular Component |
cytosol |
cytoplasm |
nucleus |
nucleoplasm |
Molecular Function |
histone methyltransferase activity (H4-R3 specific) |
|
Cellular Location
|
Not Available
|
Gene Properties |
Chromosome Location
| 19 |
Locus
| 19q13.3 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 42461.28 |
Theoretical pI
| 5.346 |
Pfam Domain Function
|
|
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>>gi|154759421|ref|NP_001527.3| protein arginine N-methyltransferase 1 isoform 1 [Homo sapiens]
MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHF
GIHEEMLKDE
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| Q99873 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
Not Available |
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:5187 |
References |
General References
| Not Available |