You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Probable cation-transporting ATPase 13A5 (HMDBP11624)
Identification | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11624 | ||||||||||
Secondary Accession Numbers | None | ||||||||||
Name | Probable cation-transporting ATPase 13A5 | ||||||||||
Synonyms |
|
||||||||||
Gene Name | ATP13A5 | ||||||||||
Protein Type | Unknown | ||||||||||
Biological Properties | |||||||||||
General Function | Not Available | ||||||||||
Specific Function | Not Available | ||||||||||
Pathways | Not Available | ||||||||||
Reactions |
|
||||||||||
GO Classification |
|
||||||||||
Cellular Location | Not Available | ||||||||||
Gene Properties | |||||||||||
Chromosome Location | 3 | ||||||||||
Locus | 3q29 | ||||||||||
SNPs | Not Available | ||||||||||
Gene Sequence | Not Available | ||||||||||
Protein Properties | |||||||||||
Number of Residues | Not Available | ||||||||||
Molecular Weight | 137325.645 | ||||||||||
Theoretical pI | 7.898 | ||||||||||
Pfam Domain Function | Not Available | ||||||||||
Signals | Not Available | ||||||||||
Transmembrane Regions | Not Available | ||||||||||
Protein Sequence |
>>gi|66730421|ref|NP_940907.2| probable cation-transporting ATPase 13A5 [Homo sapiens] MEENSKKDHRALLNQGEEDELEVFGYRDHNVRKAFCLVASVLTCGGLLLVFYWRPQWRVW ANCIPCPLQE |
||||||||||
External Links | |||||||||||
GenBank ID Protein | Not Available | ||||||||||
UniProtKB/Swiss-Prot ID | Q4VNC0 | ||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||
PDB IDs | Not Available | ||||||||||
GenBank Gene ID | Not Available | ||||||||||
GeneCard ID | Not Available | ||||||||||
GenAtlas ID | Not Available | ||||||||||
HGNC ID | HGNC:31789 | ||||||||||
References | |||||||||||
General References | Not Available |