You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Alpha-tubulin N-acetyltransferase (HMDBP11627)
Identification | |||
---|---|---|---|
HMDB Protein ID | HMDBP11627 | ||
Secondary Accession Numbers | None | ||
Name | Alpha-tubulin N-acetyltransferase | ||
Synonyms |
|
||
Gene Name | ATAT1 | ||
Protein Type | Unknown | ||
Biological Properties | |||
General Function | Not Available | ||
Specific Function | Specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. May affect microtubule stability and regulate microtubule dynamics. May be involved in neuron development. | ||
Pathways | Not Available | ||
Reactions |
|
||
GO Classification |
|
||
Cellular Location | Not Available | ||
Gene Properties | |||
Chromosome Location | 6 | ||
Locus | 6p21.33 | ||
SNPs | Not Available | ||
Gene Sequence | Not Available | ||
Protein Properties | |||
Number of Residues | Not Available | ||
Molecular Weight | 45573.35 | ||
Theoretical pI | 9.69 | ||
Pfam Domain Function |
|
||
Signals | Not Available | ||
Transmembrane Regions | Not Available | ||
Protein Sequence |
>>gi|72534730|ref|NP_001026892.1| alpha-tubulin N-acetyltransferase isoform 1 precursor [Homo sapiens] MWLTWPFCFLTITLREEGVCHLESVDLQQQIMTIIDELGKASAKAQNLSAPITSASRMQS NRHVVYILKD |
||
External Links | |||
GenBank ID Protein | Not Available | ||
UniProtKB/Swiss-Prot ID | Q5SQI0 | ||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||
PDB IDs | |||
GenBank Gene ID | Not Available | ||
GeneCard ID | Not Available | ||
GenAtlas ID | Not Available | ||
HGNC ID | HGNC:21186 | ||
References | |||
General References | Not Available |