You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Calmodulin-lysine N-methyltransferase (HMDBP11647)
Identification | |||||
---|---|---|---|---|---|
HMDB Protein ID | HMDBP11647 | ||||
Secondary Accession Numbers | None | ||||
Name | Calmodulin-lysine N-methyltransferase | ||||
Synonyms |
|
||||
Gene Name | CAMKMT | ||||
Protein Type | Unknown | ||||
Biological Properties | |||||
General Function | Not Available | ||||
Specific Function | Catalyzes the trimethylation of 'Lys-116' in calmodulin. | ||||
Pathways | Not Available | ||||
Reactions |
|
||||
GO Classification |
|
||||
Cellular Location | Not Available | ||||
Gene Properties | |||||
Chromosome Location | 2 | ||||
Locus | 2p21 | ||||
SNPs | Not Available | ||||
Gene Sequence | Not Available | ||||
Protein Properties | |||||
Number of Residues | Not Available | ||||
Molecular Weight | 36127.88 | ||||
Theoretical pI | 6.831 | ||||
Pfam Domain Function |
|
||||
Signals | Not Available | ||||
Transmembrane Regions | Not Available | ||||
Protein Sequence |
>>gi|13376109|ref|NP_079042.1| calmodulin-lysine N-methyltransferase [Homo sapiens] MESRVADAGTGETARAAGGSPAVGCTTRGPVVSAPLGAARWKLLRQVLKQKHLDDCLRHV SVRRFESFNL |
||||
External Links | |||||
GenBank ID Protein | Not Available | ||||
UniProtKB/Swiss-Prot ID | Q7Z624 | ||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||
PDB IDs | Not Available | ||||
GenBank Gene ID | Not Available | ||||
GeneCard ID | Not Available | ||||
GenAtlas ID | Not Available | ||||
HGNC ID | HGNC:26276 | ||||
References | |||||
General References | Not Available |