You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11671
Secondary Accession Numbers None
Name Probable ATP-dependent RNA helicase DDX31
Synonyms
  1. DEAD box protein 31
  2. Helicain
Gene Name DDX31
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Probable ATP-dependent RNA helicase (By similarity).
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphoric acid details
GO Classification
Cellular Component
nucleolus
Molecular Function
ATP binding
ATP-dependent helicase activity
RNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus 9q34.13
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 94086.33
Theoretical pI 9.996
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|17505907|ref|NP_073616.6| probable ATP-dependent RNA helicase DDX31 isoform 1 [Homo sapiens]
MAPDLASQRHSESFPSVNSRPNVILPGREGRREGLPPGGGTRGSLVPTRPVPPSPAPLGT
SPYSWSRSGP
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H8H2
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:16715
References
General References Not Available