You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11707
Secondary Accession Numbers None
Name ATP-dependent RNA helicase A
Synonyms
  1. RHA
  2. DEAH box protein 9
  3. Leukophysin
  4. Nuclear DNA helicase II
  5. LKP
  6. NDH II
Gene Name DHX9
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Unwinds double-stranded DNA and RNA in a 3' to 5' direction. Alteration of secondary structure may subsequently influence interactions with proteins or other nucleic acids. Functions as a transcriptional activator. Component of the CRD-mediated complex that promotes MYC mRNA stability. Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphoric acid details
GO Classification
Biological Process
mRNA splicing, via spliceosome
cellular response to heat
CRD-mediated mRNA stabilization
Cellular Component
centrosome
nucleolus
nucleoplasm
CRD-mediated mRNA stability complex
ribonucleoprotein complex
Molecular Function
ATP-dependent RNA helicase activity
double-stranded RNA binding
ATP binding
ATP-dependent DNA helicase activity
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1q25
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 140957.465
Theoretical pI 6.843
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|100913206|ref|NP_001348.2| ATP-dependent RNA helicase A [Homo sapiens]
MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSN
AARDFVNYLV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q08211
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:2750
References
General References Not Available