You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11709
Secondary Accession Numbers None
Name Decaprenyl-diphosphate synthase subunit 2
Synonyms
  1. All-trans-decaprenyl-diphosphate synthase subunit 2
  2. Candidate tumor suppressor protein
  3. Decaprenyl pyrophosphate synthase subunit 2
Gene Name PDSS2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Supplies decaprenyl diphosphate, the precursor for the side chain of the isoprenoid quinones ubiquinone-10.
Pathways
  • Terpenoid backbone biosynthesis
  • ubiquinone biosynthesis
Reactions
Farnesyl pyrophosphate + Isopentenyl pyrophosphate → Pyrophosphate + all-trans-Decaprenyl diphosphate details
GO Classification
Biological Process
regulation of body fluid levels
isoprenoid biosynthetic process
ubiquinone biosynthetic process
protein heterotetramerization
Cellular Component
cytoplasm
mitochondrion
Molecular Function
trans-hexaprenyltranstransferase activity
trans-octaprenyltranstransferase activity
protein heterodimerization activity
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6q21
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 44128.17
Theoretical pI 8.232
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|169808399|ref|NP_065114.3| decaprenyl-diphosphate synthase subunit 2 [Homo sapiens]
MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIV
GYPTSFMSLR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q86YH6
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:23041
References
General References Not Available